Recombinant Rat Frataxin, mitochondrial(Fxn)

In Stock
Code CSB-EP009086RAe1
Product Type Recombinant Protein
Size US$2632Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. D3ZYW7
Lead Time 3-7 business days
Relevance Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Research Area Tags & Cell Markers
Source E.coli
Gene Names Fxn
Expression Region 41-208aa
Tag Info Tag-Free
Mol. Weight 18.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity).
Subcellular Location Cytoplasm, cytosol, Mitochondrion
Protein Families Frataxin family
Database Links

UniGene: Rn.13133

Q&A and Customer Reviews

Q&A
Q:

We have a question about one of your products:
Has the Recombinant Rat Frataxin protein CSB-EP009086RAe1 ever been tested in Western blot or is it only tested in SDS-PAGE?

A:
Thanks for your inquiry. Regarding this item, CSB-EP009086RAe1, it is only tested in SDS-PAGE currently. But we could run WB test and show the result in CoA report, if you request. Lead time will be extended extra 3 business days for WB.
Customer Reviews

Related Products

Fxn Antibodies

Fxn Antibodies for Rattus norvegicus (Rat)

Fxn Proteins

Fxn Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.