Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1)

In Stock
Code CSB-EP009970RA
Abbreviation Recombinant Rat Gsta1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Gsta1
Uniprot No.
Research Area
Others
Alternative Names
Gsta1; Glutathione S-transferase alpha-1; EC 2.5.1.18; 13-hydroperoxyoctadecadienoate peroxidase; EC 1.11.1.-; Androst-5-ene-3,17-dione isomerase; EC 5.3.3.-; GST 1-1; GST 1a-1a; GST A1-1; GST B; Glutathione S-transferase Ya-1; GST Ya1; Ligandin
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-222aa
Target Protein Sequence
SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Rat Gsta1 protein is an E.coli-expressed protein (Full Length of Mature Protein). At the theoretical level, the steps needed for obtaining a recombinant protein are pretty straightforward. Obtain the Gsta1 gene, clone it in an expression vector, transform it into the host of choice, induce it, and then, the protein is ready for purification and characterization. In practice, however, dozens of things can go wrong. Poor growth of the host, inclusion body formation, protein inactivity, and even not obtaining any protein at all are some of the problems often found down the pipeline. So we choose the most suitable strain and vector for this recombinant Gsta1 protein expression and adopt the most optimized expression condition and purification method. Finally, mild condition and subsequent cumbersome protein-refolding procedures ensure this Gsta1 protein is soluble.

Gsta1 is a protein coding gene that encodes Glutathione S-transferase alpha-1. According to some studies, Gsta1 may have the following features.
The expression of GSTA1 was increased in PIA. The low levels of GSTA1 and GSTP1 in HGPIN and adenocarcinomas suggest a widespread lack of detoxification activity in these cells, which may be related to the oncogenicity of the prostate. Human GSTA1-1 reduces c-Jun N-terminal kinase signaling and apoptosis in Caco-2 cells. GSTA1 can be detected at low concentrations during the early stages of acute liver injury. GSTA1 is a more sensitive and accurate indicator than ALT. UGT1A1 and GSTA1 are regulated by soda through distinct signaling pathways, and differences in the regulatory mechanisms of UGT1A1 transcription.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glutathione S-transferase that catalyzes the nucleophilic attack of the sulfur atom of glutathione on the electrophilic groups of a wide range of exogenous and endogenous compounds (Probable). Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). It also catalyzes the isomerization of D5-androstene-3,17-dione (AD) into D4-androstene-3,17-dione and may therefore play an important role in hormone biosynthesis. Through its glutathione-dependent peroxidase activity toward the fatty acid hydroperoxide (13S)-hydroperoxy-(9Z,11E)-octadecadienoate/13-HPODE it is also involved in the metabolism of oxidized linoleic acid.
Gene References into Functions
  1. The most sensitive, noninvasive biomarkers of HCBD-induced renal toxicity in Hanover Wistar rats were urinary alpha-GST and KIM-1. PMID: 21905055
  2. Mechanism of negative regulation of rat glutathione S-transferase A2 by the cytokine interleukin 6. PMID: 11939905
  3. Oltipraz-induced GSTA2 gene expression is dependent upon PI3-kinase-mediated nuclear translocation and binding of C/EBP-beta to the GSTA2 gene promoter. PMID: 12509401
  4. Single mutations are introduced to evaluate the importance of amino acids at the subunit interface of GSTA1-1. Phe52 and Arg69 are found to be major determinants of dimer formation: a single mutation at either position substantially hinders dimerization. PMID: 15035604
  5. P.893: Ceramide inhibits C/EBP-beta or Nrf2 activation, which contributes to repression of GSTA2 gene transactivation. P. 897: "...ceramide inhibition of... transcription factors contributes to the repression of the GSTA2 gene transactivation." PMID: 15319326
  6. C/EBP alpha and beta are involved in glucocorticoid-dependent repression of GSTA2 gene expression PMID: 17786629

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
GST superfamily, Alpha family
Database Links

KEGG: rno:24422

UniGene: Rn.144550

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*