Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)

Code CSB-EP009970RA
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Gsta1
Uniprot No. P00502
Research Area Others
Alternative Names Gsta1; Glutathione S-transferase alpha-1; EC 2.5.1.18; 13-hydroperoxyoctadecadienoate peroxidase; EC 1.11.1.-; Androst-5-ene-3,17-dione isomerase; EC 5.3.3.-; GST 1-1; GST 1a-1a; GST A1-1; GST B; Glutathione S-transferase Ya-1; GST Ya1; Ligandin
Species Rattus norvegicus (Rat)
Source E.coli
Expression Region 2-222aa
Target Protein Sequence SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 41.5kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Gene References into Functions
  1. The most sensitive, noninvasive biomarkers of HCBD-induced renal toxicity in Hanover Wistar rats were urinary alpha-GST and KIM-1. PMID: 21905055
  2. Mechanism of negative regulation of rat glutathione S-transferase A2 by the cytokine interleukin 6. PMID: 11939905
  3. Oltipraz-induced GSTA2 gene expression is dependent upon PI3-kinase-mediated nuclear translocation and binding of C/EBP-beta to the GSTA2 gene promoter. PMID: 12509401
  4. Single mutations are introduced to evaluate the importance of amino acids at the subunit interface of GSTA1-1. Phe52 and Arg69 are found to be major determinants of dimer formation: a single mutation at either position substantially hinders dimerization. PMID: 15035604
  5. P.893: Ceramide inhibits C/EBP-beta or Nrf2 activation, which contributes to repression of GSTA2 gene transactivation. P. 897: "...ceramide inhibition of... transcription factors contributes to the repression of the GSTA2 gene transactivation." PMID: 15319326
  6. C/EBP alpha and beta are involved in glucocorticoid-dependent repression of GSTA2 gene expression PMID: 17786629

Show More

Hide All

Subcellular Location Cytoplasm
Protein Families GST superfamily, Alpha family
Database Links

KEGG: rno:24422

UniGene: Rn.144550

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1