Recombinant Rat Glutathione S-transferase alpha-1(Gsta1)

Code CSB-EP009970RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P00502
Relevance Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;Ligandin
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Research Area Others
Source E.coli
Gene Names Gsta1
Protein Names Recommended name: Glutathione S-transferase alpha-1 EC= 2.5.1.18 Alternative name(s): GST 1-1 GST 1a-1a GST A1-1 GST B Glutathione S-transferase Ya-1 Short name= GST Ya1 Ligandin
Expression Region 2-222aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 41.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Subcellular Location Cytoplasm
Protein Families GST superfamily, Alpha family
Database Links

KEGG: rno:24422

UniGene: Rn.144550

Related Products

Gsta1 Antibodies

Gsta1 Antibodies for Rattus norvegicus (Rat)

Gsta1 Proteins

Gsta1 Proteins for Rattus norvegicus (Rat)

Gsta1 ELISA Kit

Gsta1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.