Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Mt3

Uniprot No.

P37361

Research Area

Neuroscience

Alternative Names

Growth inhibitory factor;Metallothionein-III

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

1-66aa

Target Protein Sequence

MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEKCSCCQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.

Gene References into Functions

After passing middle age we observe a huge increase in MT3 transcripts in both cortical and hippocampal areas, while the MT1/2 mRNA content increases slightly PMID: 27939232
Neuroprotective effect of propofol in hypoxia-reoxygenation injury of hippocampal neurons may be via upregulation of Mt3. PMID: 22367221
metallothionein III, in the presence of brain extract, is a potent inhibitor of neurite sprouting, and may be involved in abnormal sprouting potentially underlying both Alzheimer's disease and epilepsy. PMID: 12460603
Systemic application of kainic acid (KA) rapidly induced MT-I and II expression in neurons localized in hippocampal formation, piriform cortex, and amygdala of the adult rat, whereas the level of MT-III mRNA was decreased in KA-vulnerable areas PMID: 12692462
A recombinant adenoviral vector encoding GIF prevents degeneration of motoneurons in rats after facial nerve avulsion. PMID: 14625437
differential display proteomics techniques identified ten significantly and reproducibly changed proteins induced by transient transfection of MT-3 in PC-12 cells; their functional implications are discussed PMID: 14998173
A large amount of free zinc ions can be sequestered by metallothionein-3 in the hippocampus of old rats, leading to impaired zinc-dependent functions in the ageing brain. PMID: 15130702
analysis of the epitope of neuronal growth inhibitory factor (GIF) PMID: 16336778
mutation of MT3 at Glu23 may alter the NO metabolism and/or affect zinc homeostasis in brain, thus altering the neuronal growth inhibitory activity PMID: 16945328
The localization of MT-3 in peripheral organs outside the brain suggests that MT-3 has roles in these tissues besides its role in growth inhibition of neurites. PMID: 18479819

Hide All

Protein Families

Metallothionein superfamily, Type 1 family

Tissue Specificity

Brain.

Database Links

KEGG: rno:117038

STRING: 10116.ENSRNOP00000025669

UniGene: Rn.11325

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP015122RA
Abbreviation	Recombinant Rat Mt3 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Metallothionein-3 (Mt3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage