| Code | CSB-YP019000RA |
| Abbreviation | Recombinant Rat Ptma protein |
| MSDS | |
| Size | $306 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I am interested in the product below.
https://www.hoelzel-biotech.com/en/cusabio-proteins-other-csb-yp019000ra-100-recombinant-rat-prothymosin-alphaptma.html
I would like to use the protein to do assay.
Do you know how much percentage of homology of rat PTMA to human PTMA?
SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD