Recombinant Rat Prothymosin alpha(Ptma)

In Stock
Code CSB-YP019000RA
Size US$1593Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Ptma
Uniprot No. P06302
Research Area Others
Alternative Names Ptma; Prothymosin alpha [Cleaved into: Prothymosin alpha; N-terminally processed; Thymosin alpha]
Species Rattus norvegicus (Rat)
Source Yeast
Expression Region 2-112aa
Target Protein Sequence SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 14.3kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

I am interested in the product below.
https://www.hoelzel-biotech.com/en/cusabio-proteins-other-csb-yp019000ra-100-recombinant-rat-prothymosin-alphaptma.html
I would like to use the protein to do assay.
Do you know how much percentage of homology of rat PTMA to human PTMA?

A:
Thanks for your inquiry. Recombinant Rat Prothymosin alpha(Ptma)
CSB-YP019000RA >> Yeast 3-7 working days
Expression Region: 2-112aa; Full length.
Tag information:N-terminal 6xHis-tagged
Sequence:

SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD


The homology between rat PTMA and human PTMA is 95%. https://blast.ncbi.nlm.nih.gov/Blast.cgi
If you need Human PTMA, we also have this protein, please check as follows:
Recombinant Human Prothymosin alpha(PTMA)
CSB-YP019000HUb0 N-terminal 10xHis-tagged
CSB-YP019000HU N-terminal 6xHis-tagged
Expression Region: 1-111aa;Full length.
Sequence:

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

 Customer Reviews

Target Data

Function Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Subcellular Location Nucleus
Protein Families Pro/parathymosin family
Database Links

KEGG: rno:100359583

STRING: 10116.ENSRNOP00000059708

UniGene: Rn.817

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1