Recombinant Rat Prothymosin alpha(Ptma)

In Stock
Code CSB-YP019000RA
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P06302
Lead Time 3-7 business days
Relevance Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD
Research Area Others
Source Yeast
Gene Names Ptma
Protein Names Recommended name: Prothymosin alpha Cleaved into the following chain: 1. Thymosin alpha
Expression Region 2-112aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Subcellular Location Nucleus
Protein Families Pro/parathymosin family
Database Links

KEGG: rno:100359583

STRING: 10116.ENSRNOP00000059708

UniGene: Rn.817

Q&A and Customer Reviews

Q&A
Q:

I am interested in the product below.
https://www.hoelzel-biotech.com/en/cusabio-proteins-other-csb-yp019000ra-100-recombinant-rat-prothymosin-alphaptma.html
I would like to use the protein to do assay.
Do you know how much percentage of homology of rat PTMA to human PTMA?

A:
Thanks for your inquiry. Recombinant Rat Prothymosin alpha(Ptma)
CSB-YP019000RA >> Yeast 3-7 working days
Expression Region: 2-112aa; Full length.
Tag information:N-terminal 6xHis-tagged
Sequence:

SDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD


The homology between rat PTMA and human PTMA is 95%. https://blast.ncbi.nlm.nih.gov/Blast.cgi
If you need Human PTMA, we also have this protein, please check as follows:
Recombinant Human Prothymosin alpha(PTMA)
CSB-YP019000HUb0 N-terminal 10xHis-tagged
CSB-YP019000HU N-terminal 6xHis-tagged
Expression Region: 1-111aa;Full length.
Sequence:

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Customer Reviews

Related Products

Ptma Proteins

Ptma Proteins for Rattus norvegicus (Rat)

Ptma ELISA Kit

Ptma ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.