Recombinant Rat Regucalcin (Rgn)

Code CSB-EP019630RA
Abbreviation Recombinant Rat Rgn protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Rgn
Uniprot No.
Research Area
Others
Alternative Names
Rgn; Smp30; Regucalcin; RC; Gluconolactonase; GNL; EC 3.1.1.17; Senescence marker protein 30; SMP-30
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-299aa
Target Protein Sequence
MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGNIFKITGLGVKGIAPYSYAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can I please get CSB-EP019630RA, without glycerol. I am mainly curious about getting this larger quantity without glycerol. How long would it take and would it be lyophilized or in liquid format?

A:
Very nice to receive your inquiry.Our default buffer is Tris-based buffer, 50% glycerol. We could provide this protein without glycerol, and this protein is quite stable without glycerol.
There is no problem as long as you won't store this protein for too long time before using it.
We could also deliver this protein in lyophilized powder. It will take 2-3 working days to lyophilize it. Please kindly remark your requirement for delivery form when placing your order.

Target Background

Function
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling, and Ca(2+)-dependent cellular processes and enzyme activities.
Gene References into Functions
  1. The renal SMP30 expression levels positively correlated with plasma testosterone levels in the kidney. PMID: 27553527
  2. Melatonin may produce a neuroprotective effect through its antioxidant action and by increasing hippocampal expression of SMP30 and osteopontin. PMID: 29602294
  3. n. These results showed the effect of RGN in inhibiting the glycolytic metabolism in rat prostate, which was underpinned by a reduced cell proliferation index. The present findings also suggest that the loss of RGN may predispose to a hyper glycolytic profile and fostered proliferation of prostate cells PMID: 26553531
  4. results highlighted the importance of RGN as a regulatory protein in Ca2+-dependent signaling pathways and its deregulation of RGN expression by Ca2+o may contribute for onset and progression of PCa. PMID: 26171977
  5. RGN overexpression protects germ cell from apoptosis induced by noxious stimuli, which could be a relevant mechanism for fertility preservation in situations of oncological treatments. PMID: 24519986
  6. A diminished influx of Ca2+ in epididymal tissues of RGN-overexpressing rats resulted in compromised sperm motility. PMID: 23615721
  7. Regucalcin may play a pivotal role in the regulation of Ca(2+) signaling which is stimulated through a neurotransmitter in the brain neurons with aging PMID: 22652898
  8. existence of multiple forms of SMP30 PMID: 21347421
  9. Rgn is a novel androgen-target gene in rat testis and may have a role in male reproductive function, particularly in the control of spermatogenesis. PMID: 21680783
  10. Studies indicate that regucalcin plays an important role as a regulatory protein in cell signaling system, and it is proposed to play a pivotal role in keep of cell homeostasis and function. PMID: 21431902
  11. SMP30 protein levels were not altered in cortex and cerebellum of young (6 months) and old (21 months) rats. PMID: 19437547
  12. effect of regucalcin, a regulatory protein of Ca2+ signaling, on guanosine-5'-triphosphatase (GTPase) activity in isolated rat liver plasma membranes was investigated; GTPase activity was significantly increased by the addition of Ca2+ PMID: 11693188
  13. study demonstrates that endogenous regucalcin has a suppressive effect on DNA synthesis in the nuclei of rat renal cortex PMID: 11936841
  14. endogenous regucalcin plays a suppressive role in the enhancement of nuclear DNA synthesis activity in regenerating liver with cell proliferation after partial hepatectomy in rats. PMID: 11967991
  15. Role of regucalcin as an activator of sarcoplasmic reticulum Ca2+-ATPase activity in rat heart muscle PMID: 12112029
  16. Role of endogenous regucalcin in transgenic rats: suppression of kidney cortex cytosolic protein phosphatase activity and enhancement of heart muscle microsomal Ca2+-ATPase activity PMID: 12210758
  17. endogenous regucalcin has a suppressive effect on the enhancement of RNA synthesis activity in the nucleus of regenerating rat liver with proliferative cells PMID: 12397604
  18. recombinant RGPR-p117 did not bind directly to the TTGGC sequence of the regucalcin gene promoter region in liver PMID: 12647292
  19. has a suppressive effect on nitric oxide synthase activity in the liver cytosol; may play important role as a regulatory protein of NO synthase in liver cells PMID: 12647304
  20. Endogenous regucalcin has an inhibitory effect on NO synthase activity in the brain cytosol of young and aged rats PMID: 12686401
  21. The present study demonstrates that endogenous regucalcin has a suppressive effect on NO synthase activity in the kidney cortex cytosol of rats PMID: 12851718
  22. endogenous regucalcin plays a suppressive role in the regulation of liver nuclear function in rats PMID: 12851719
  23. endogenous regucalcin plays a suppressive role in the regulation of brain function in rats PMID: 12964038
  24. regucalcin is expressed in rat bone marrow cells, and osteoclastic bone resorption is stimulated in regucalcin transgenic rats with increasing age PMID: 14767576
  25. overexpression of regucalcin has a suppressive effect on cell death induced by TNF-alpha or thapsigargin PMID: 15108356
  26. Senescence marker protein-30 is a unique enzyme that hydrolyzes diisopropyl phosphorofluoridate in the liver PMID: 15251439
  27. regucalcin modulates the transcriptional process by binding to protein and DNA in the nucleus PMID: 15254778
  28. Endogenous rgn suppresses protein tyrosine phosphatase activity in rat liver microsomes in transgenic rats. PMID: 15289895
  29. Osteoclastic bone resporption is stimulated in regucalcin transgenic male and female rats with increasing age. PMID: 15289899
  30. The effect of regucalcin in increasing superoxide dismutase (SOD) activity may not involve the sulfhydryl group of SOD. PMID: 15340235
  31. hyperlipidemia is uniquely induced in regucalcin TG rats with increasing age PMID: 15375596
  32. regucalcin increases superoxide dismutase activity in the heart cytosol of rats, and its effect is not related to the sulfhydryl group of enzymes PMID: 15375603
  33. This study demonstrates that regucalcin directly stimulates osteoclast-like cell formation in mouse marrow culture in vitro, and that the protein stimulates bone resorption in rat femoral tissues in vitro PMID: 15578574
  34. Overexpression of regucalcin suppresses sulforaphane-induced apoptotic cell death which is partly mediated through caspase-3. PMID: 15806309
  35. study demonstrates that regucalcin regulates the function of osteoblastic cells, and that the protein suppresses cell differentiation and mineralization PMID: 16052480
  36. Results demonstrate that overexpression of regucalcin has a suppressive effect on cell proliferation, which is mediated through various signaling pathways. PMID: 16142398
  37. This study demonstrates that overexpression of RGPR-p117 enhances the expression of regucalcin mRNA and its protein level in NRK52E cells. RGPR-p117 may play a role as a transcriptional factor. PMID: 16273285
  38. RGPR-p117 can enhance the regucalcin promoter activity which is related to the NF-1 consensus sequences including TTGGC motif, and its enhancing effect is partly mediated through phosphorylation and dephosphorylation PMID: 16676356
  39. the SMP30 transcriptional process is redox-sensitive and its modulation occurs at DNA binding sites 3 and 5 in the promoter region PMID: 16677110
  40. This study demonstrates that overexpression of regucalcin caused a remarkable increase in its nuclear localization, and that it has suppressive effects on the gene expression of L-type Ca(2+) channel or CaR. PMID: 16767692
  41. Results suggest regucalcin has a role in the regulation of heart mitochondrial function. PMID: 16786169
  42. Regucalcin does not have effects as the suppressor for free radical stress and the scavenger for free radical in rats. PMID: 17334641
  43. Leptin mRNA expression in the adipose or liver tissues was significantly decreased in 50-week-old regucalcin transgenic rats. PMID: 17671736
  44. This study demonstrates that overexpression of regucalcin suppresses the enhancing effect of insulin or glucose on the gene expression of insulin signaling-related proteins in the cloned rat hepatoma H4-II-E cells. PMID: 17912465
  45. Data show that regucalcin mRNA and protein are present in rat mammary gland that estradiol down-regulates regucalcin expression. PMID: 18157649
  46. regucalcin has a role in the regulation of Ca(2+)-ATPase activity in the brain mitochondria of rats PMID: 18181158
  47. These studies provide novel insights into the mechanism that regulate SMP30 gene expression. PMID: 18442420

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
SMP-30/CGR1 family
Tissue Specificity
Detected in liver (at protein level). Hepatocytes and renal proximal tubular epithelium.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*