Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Scn9a

Uniprot No.

O08562

Research Area

Neuroscience

Alternative Names

Peripheral sodium channel 1;Sodium channel protein type IX subunit alpha;Voltage-gated sodium channel subunit alpha Nav1.7

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

1-125aa

Target Protein Sequence

MAMLPPPGPQSFVHFTKQSLALIEQRISEEKAKEHKDEKKDDEEEGPKPSSDLEAGKQLPFIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKAIFRFNATPALYMLSPFSPLRRISIKILVH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

21.1 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Datasheet & COA

Please contact us to get it.

Target Background

Function

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain.

Gene References into Functions

Nav1.7 of L4-L6 dorsal root ganglion plays an important role in the development of pain hypersensitivity after plantar incision. PMID: 29790813
the presence of Nav1.7 mRNA and protein in dorsal root ganglia but not in embryonic hippocampal neurons. PMID: 29166836
The expression of Nav1.7 is up-regulated in dorsal root ganglion up to 20 days after surgery compared to control groups. PMID: 29115943
SCN9A gene modification can promote the expression of Nav1.8 and Nav1.9 channels, in addition to NGF which may provide a novel therapeutic basis for treating of diarrheapredominant irritable bowel syndrome. PMID: 29138838
PGE2 was an important regulator of Nav1.7 in TMJ inflammatory pain PMID: 28349234
This study demonstrated that the expression of miR-30b and Nav1.7 was down-regulated and up-regulated, respectively, in the dorsal root ganglion of spared nerve injury rats PMID: 27765894
Estradiol could upregulate trigeminal ganglionic Nav1.7 expression to contribute to hyperalgesia of inflamed temporomandibular joint. PMID: 28582470
This study demonstrated that Positive immunoreactivity was found for NaV1.1, predominantly in sensory terminals together with NaV1.6 and for NaV1.7. PMID: 28123009
Nav1.7 plays a vital role in lowering heat pain threshold after burn injury; shRNA mediated knockdown of Nav1.7 attenuates burn induced pain in rats as well as decreased the activation of c-fos protein. PMID: 27514860
The role of NaV1.7 channels in the transmission of muscle afferent input evoking the exercise pressor reflex is reported in decerebrated, unanesthetized rats. PMID: 26310938
De novo expression of Nav1.7 mRNA in putative proprioceptive neurons and increase in Nav1.7-ir fibers in the ipsilateral gracile nucleus following spinal nerve ligation may suggest functional changes in touch sense pathways after peripheral nerve injury PMID: 25453779
Studied pain-related behavior and expression of NaV1.7 in dorsal root ganglia (DRG) after combined sciatic nerve compression and nucleus pulposus (NP) application in rats. PMID: 24253930
disc injury increases NaV1.7 expression in dorsal root ganglia neurons innervating injured discs PMID: 24480965
TNF-alpha up-regulates NaV1.7 mRNA in both adrenal chromaffin cells and dorsal root ganglia (DRG) neurons, highlighting the peripheral nociceptive mechanism of TNF-alpha PMID: 24445633
Nav 1.7 has an important function in the hyperalgesia of the inflamed temporomandibular joint, which is dependent on the communication with the satellite glials PMID: 23242737
NaV1.7 is present within neurosecretory neurons of rat supraoptic nucleus, where the level of immunoreactivity is dynamic, increasing in response to osmotic stress PMID: 23924059
The expression of Nav1.7 in DRG neurons extends from peripheral terminals in the skin to preterminal central branches and terminals in the dorsal horn. PMID: 23134641
the involvement of functional voltage-gated sodium channels expression as a potentiating factor in metastatic prostate cancer has been confirmed in vivo for the first time PMID: 22484465
Na(V)1.7 expression in the rat, highest mRNA expression levels are found in peripheral ganglia, and the protein is expressed within these ganglion cells and on the projections of these neurons in the central nervous system. PMID: 17722032
Nerve growth factor did not affect the Nav1.7 mRNA level, but the total voltage-gated Na+ channel alpha-subunit protein level was upregulated. PMID: 17149708
Nav1.7 is the dominant sodium channel in rat and mouse olfactory sensory neurons. PMID: 21569247
We demonstrate increased levels of Na(V)1.7 in experimental rat sciatic nerve neuromas, 2weeks after nerve ligation and transaction. PMID: 21601570
Na(V)1.7 plays a role in the maintenance of chronic inflammatory pain several weeks after the initial insult. PMID: 17950013
The results of these studies suggest that activation of the presynaptic delta-opioid receptor by enkephalin prevents the increase in neuronal Na(V)1.7 in DRG through inhibition of PKC and p38. PMID: 18579738
Na(v)1.7 plays a major role in pain and is inhibited by the sodium channel blocker BZP PMID: 19690272

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell projection, neuron projection.

Protein Families

Sodium channel (TC 1.A.1.10) family, Nav1.7/SCN9A subfamily

Tissue Specificity

Expressed at high level in the dorsal root ganglion and at much lower levels in the brain, sciatic nerve, nodose ganglia, heart, thyroid and adrenal glands and Schwann cells, but not in the cardiac and skeletal muscles, brain and liver.

Database Links

KEGG: rno:78956

STRING: 10116.ENSRNOP00000059170

UniGene: Rn.88082

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP020846RA
Abbreviation	Recombinant Rat Scn9a protein, partial
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Sodium channel protein type 9 subunit alpha (Scn9a), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage