Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Sult1b1; St1b1; Sulfotransferase family cytosolic 1B member 1; ST1B1; Sulfotransferase 1B1; EC 2.8.2.-; DOPA/tyrosine sulfotransferase
Species
Rattus norvegicus (Rat)
Expression Region
1-299aa
Target Protein Sequence
MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Rat Sult1b1 contains amino acids 1-299. The calculated molecular weight for this Sult1b1 protein is 54.8 kDa. This Sult1b1 recombinant protein is manufactured in e.coli. The Sult1b1 coding gene included the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant Sult1b1 protein in following stages of expression and purification.
Sulfotransferase family cytosolic 1B member 1 (Sult1b1) is an enzyme belonging to the sulfotransferase family, playing a crucial role in the phase II detoxification pathway. Sult1b1 is responsible for catalyzing the transfer of a sulfate group from 3'-phosphoadenosine-5'-phosphosulfate (PAPS) to a variety of substrates, including hormones, drugs, and xenobiotics. This sulfonation process enhances the water solubility of these compounds, facilitating their excretion from the body. In rats, Sult1b1 is expressed in various tissues, with prominent activity in the liver. Understanding the function of Sult1b1 is essential for elucidating detoxification mechanisms, drug metabolism, and the regulation of endogenous substances in rodents. Research on Sult1b1 contributes to advancements in drug development, toxicology, and the overall comprehension of metabolic pathways in rats.
