Recombinant Rat Vesicular glutamate transporter 1 (Slc17a7), partial

Code CSB-YP730797RA
Abbreviation Recombinant Rat Slc17a7 protein, partial
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
1-63aa
Target Protein Sequence
MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Gene References into Functions
  1. findings indicate that unilateral cochlear ablation suppresses VGLUT1 expression in the central auditory pathways not only ipsilateral but also contralateral to the ablated side. PMID: 28238468
  2. VGLUT1 was transiently down-regulated in ipsilateral dorsal root ganglia and contralateral spinal cord in a model of spared nerve injury. PMID: 27210824
  3. In previously unstressed rats, vGluT1 siRNA significantly enhanced ACTH and corticosterone secretion. Compared with chronic variable stress (CVS) animals receiving the green fluorescent protein control vector, the vGluT1 siRNA further increased basal and stress-induced corticosterone release. Further analysis revealed enhanced adrenal responsiveness in CVS rats treated with vGluT1 siRNA. PMID: 28938481
  4. results indicated that VGLUT1v exists in a functional state in rat photosensitive cells and is involved in glutamatergic chemical transmission PMID: 28188742
  5. vGlut1 has a strong influence on the kinetics of retrieval of half of the known SV cargos and that specifically impairing the endocytosis PMID: 26224632
  6. The results indicated that glutamatergic spinal trigeminal nucleus neurons sending their axons to the cerebellar cortical regions mainly express VGLUT1. PMID: 23380804
  7. Following peripheral nerve injury, 62% of VGLUT1 synapses are lost on spinal motor neuron dendrites. PMID: 24599449
  8. VGLUT1 contains multiple sorting signals that engage distinct trafficking mechanisms PMID: 23804088
  9. These results suggest that BDNF regulates VGLUT expression during development and its effect on VGLUT1 may contribute to enhance glutamate release in LTP PMID: 23326507
  10. Up-regulation of VGLUT1 is important for development of presynaptic terminals in the cortex. PMID: 23226425
  11. VGluT1 immunoreactions are localized within the cytoplasm for all sizes of trigeminal neurons, although predominantly in medium-large trigeminal neurons. PMID: 21957077
  12. VGLUT1 labeling is concentrated in astrocytic processes from wild type, and not in VGLUT1 knockout hippocampus. PMID: 22009457
  13. Expression of VGLUT2 precedes that of VGLUT1 during olfactory bulb morphogenesis, suggesting differential contribution of the two VGLUT subtypes to glutamate-mediated embryonic events. PMID: 21609737
  14. After nerve injuries synapses are stripped from motoneurons, other excitatory and inhibitory inputs eventually recover but VGLUT1 synapses are permanently lost on the cell body (75-95% synaptic losses) and on the proximal 100 mum of dendrite (50% loss). PMID: 21832035
  15. The VGLUT1 upstream promoter and the first intron, fused to the basal promoter, both support glutamatergic-specific expression in rat postrhinal cortex. PMID: 21172319
  16. The vesicular glutamate transporter-1 (VGLUT1)promoter supports expression in VGLUT1-containing glutamatergic neurons in rat postrhinal cortex. PMID: 20849834
  17. Most of the glutamatergic neurons that expressed glutamate vesicular transporter 1 also co-expressed choline acetyltransferase. PMID: 20632124
  18. There are regionally significant correlations between VGLUT1 concentration and cognitive scores between different dementia groups and those with stroke who do not develop dementia. PMID: 21079182
  19. observed a biphasic and bilateral change in the protein expression levels of both VGLUTs in the striatum of hemi-Parkinson rats indicative for a different and time-dependent change in glutamatergic neurotransmission from two types of striatal afferents PMID: 20450947
  20. The study suggested that VGLUT enhances transmitter storage in nonglutamatergic neurons. PMID: 20519538
  21. The presence of the glutamate markers VGLUT1 and VGLUT2 in distinct populations of peptide hormone-secreting hypophysial cells highly indicates the involvement of endogenous glutamate release in autocrine/paracrine regulatory mechanisms PMID: 20025917
  22. These findings show the specific lingual pattern of distribution for VGluts and suggest that only VGlut 1 takes part in glutamatergic regulation of epithelial and taste cells within the tongue in physiological conditions. PMID: 19952853
  23. VGLUT1 immunoreactivity was detected in the sensory endings on the equatorial and juxta-equatarial regions of intrafusal fibers as well as in many axon terminals within lamina IX of the spinal cord. PMID: 15157812
  24. VGLUT1 provides a specific marker for glutamatergic neuronal elements in the septal hippocampus. PMID: 15224985
  25. The developmental pattern of Vglut1 in the olivary nucleus was studied. PMID: 15714284
  26. the coupling of zinc transporter 3 and Vglut1 transport mechanisms regulates neurotransmitter content in secretory vesicles PMID: 15860731
  27. A newly proposed mechanism for altering the strength of glutamatergic synapses based on the recently identified vesicular glutamate transporter VGLUT1. PMID: 15987952
  28. a high proportion of cardiac neurones appear to be glutamatergic, but differ from other vagal afferents in expressing vesicular glutamate transporter 1 PMID: 16084661
  29. VGLUT1-ir was found in extrinsic as well as intrinsic innervation of the rat esophagus. PMID: 16231188
  30. Overall, the discovery of endophilin as a partner for VGLUT1 in nerve terminals strongly suggests the existence of functional differences between VGLUT1 and -2 terminals in their abilities to replenish vesicle pools. PMID: 16606361
  31. VGLUT1 and endophilins may interact to play an important role affecting the vesicular sequestration and synaptic release of glutamate. PMID: 16710756
  32. Lamina I and IIo displayed a moderate density of small VGLUT1 varicosities at all spinal levels. Corticospinal tract axons displayed VGLUT1, indicating that the corticospinal tract is an important source of small VGLUT1 varicosities. PMID: 16786558
  33. After stimulation, inhibition of the AP3 pathway prevents the full recovery of VGLUT1 by endocytosis, implicating the AP3 pathway specifically in compensatory endocytosis. PMID: 16815333
  34. These data indicate that VGLUT1 is expressed in both the central axon terminals and the peripheral sensory endings of Vmes neurons, although no VGLUT1 immunoreactivity was detectable in the cell bodies of Vmes neurons in adult rats. PMID: 16856164
  35. In situ hybridization with variant-specific probes showed expression of VGLUT1v in the inner segment layer of photoreceptor cells. PMID: 16987242
  36. No significant change in either VGLUT1 or GlyT2 labeling of sacrocaudal motoneurons at any of the time points examined. PMID: 17134699
  37. There was a striking loss of mossy cells during the latent period, demonstrated by a long-term decrease of VGLUT1 mRNA-containing hilar neurons and associated loss of VGLUT1-containing terminals in the dentate gyrus. PMID: 17503488
  38. VGluT1 was localized to partial neurons of VG and to the putative primary afferent fibers innervating vestibular end-organs. PMID: 17612597
  39. Histological analysis revealed that intensities of VGLUT1 hybridization signal and immunostaining drastically increase by postnatal day (P) 7 in pinal gland. PMID: 18291592
  40. Results showed numerous VGLUT1 immunolabeled terminals in the central nucleus, lateral cortex and dorsal cortex, and Results showed numerous VGLUT1 and 2 immunolabeled terminals in the central nucleus, lateral cortex and dorsal cortex. PMID: 18436385
  41. In rat retina, VGLUT1 was initially detected at postnatal day (P5) in photoreceptor terminals and P6 in bipolar terminals. PMID: 18482716
  42. In the present study observed a higher expression of vglut1 mRNA in the left cingulate cortex. This suggests a hemispheric asymmetry in the strength of the cortico-subcortical glutamatergic system. PMID: 19626270
  43. In cortical cultures and layer V cortical terminals VGLUT1 is coexpressed with vesicular transporter VGAT in the same population of synaptic vesicles. PMID: 19627441

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily
Tissue Specificity
Expressed in the cerebellum, cerberal cortex and hippocampus. Isoform 2 is expressed specifically in retina.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*