Recombinant Rat Vesicular glutamate transporter 3 (Slc17a8), partial

Code CSB-YP763188RA
Abbreviation Recombinant Rat Slc17a8 protein, partial
MSDS
Size $436
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(VGluT3)(Solute carrier family 17 member 8)
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
1-76aa
Target Protein Sequence
MPFNAFDTFKEKILKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRARAPVCDCSCCGIPKRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
9.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Gene References into Functions
  1. Chronic voluntary wheel running results in increased gene expression of VGLUT3 (and GLT-1) in the frontal cortex without changes in other glutamate transporter subtypes. PMID: 29375045
  2. VGLUT3 is involved in the pathogenesis of visceral hyperalgesia in a rat model of irritable bowel syndrome. PMID: 25780293
  3. VGLUT3 likely has developmental and physiological roles in the rat cochlea during postnatal development as well as later in life PMID: 24064385
  4. The results of this study rat brains showing that small, clear, and round synaptic vesicles in gamma-aminobutyric acid (GABA)-ergic nerve terminals contain labeling for both VGLUT3 and the vesicular GABA transporter . PMID: 23633129
  5. VGLUT3-immunoreactive boutons in the lateral sinus form two different, disproportionate, populations of synaptic contacts with their target neurons. PMID: 22374223
  6. VGLUT3 localizes to a distinct set of synaptic-like microvesicles in perisynaptic astroglial processes and may be important for glutamate release from astrocytes. PMID: 22573606
  7. The periodontal Ruffini endings of rat incisors show both VGluT1 and VGluT2, and lack VGluT3. PMID: 21957077
  8. projections between the arcuate nucleus and ventrolateral periaqueductal gray are available to participate in prolonged modulation by electroacupuncture and that VGLUT3-containing neurons are an important neuronal phenotype involved in this process PMID: 20836994
  9. These results suggest that VGLUT3-expressing nonserotonergic neurons in the midbrain raphe nuclei are preferentially distributed in the DRDSh and modulate many brain regions with the neurotransmitter glutamate via ascending axons. PMID: 20034056
  10. Taken together, these findings indicate locally collateralizing glutamate neurons responsive to substance P contain VGLUT3. PMID: 19467322
  11. dendritic expression of VGLUT3 by particular neurons also indicates the potential for retrograde synaptic signaling PMID: 12388773
  12. In the rat retina, the dendrites of vGluT3 amacrine cells form a dendritic tree that is bistratified in the inner plexiform layer. The vGluT3 cells have a dendritic overlap and form a regular mosaic, suggesting a single type of amacrine cell. PMID: 14648683
  13. Weak expression of VGLUT3 mRNA is only detected in deep laminae of lumbar spinal cord. PMID: 14681932
  14. Neurons containing VGLUT3 transcript are essentially observed in the caudate-putamen, the olfactory tubercle, the nucleus accumbens, the hippocampus, the interpeduncular nucleus and the dorsal and medial raphe nuclei. PMID: 14751290
  15. The results suggest that boutons coexpressing VGLUT3, CCK and GAD originate from CCK-positive basket cells, which are VIP-immunonegative. PMID: 14984406
  16. VGLUT3-expressing GABAergic interneurons form a chemically specific circuit within the preprotachykinin B-producing interneuron group. PMID: 15142960
  17. The developmental pattern of Vglut3 in the olivary nucleus was studied. PMID: 15714284
  18. These findings support our hypothesis that neurons and fibers containing VGLUT3 lie in close proximity to those containing nNOS and that both proteins colocalize in some neurons and fibers in the NTS. PMID: 15820620
  19. Between P1 and P15, VGLUT3 is observed in the frontal brain and in the caudal brain During a second phase extending from P15 to adulthood, the labeling of the caudal brain fades away. The adult pattern is reached at P21. PMID: 16182324
  20. VGLUT3 identifies a novel excitatory terminal subset that contributes to the tuning of DA cell excitability in the substantia nigra. PMID: 16519671
  21. Intense VGluT3 immunoreactivity was detected in large number of sensory epithelia cells PMID: 17612597
  22. The present study shows that midbrain raphe-derived 5-HT fibers can be classified into two subtypes depending on co-expression with VGLUT3 staining in the forebrain. PMID: 18222609
  23. Expression of VGLUT3 was first observed at postnatal day 10 (P10) in amacrine cell soma and some processes, which extensively arborized in both the ON and OFF sublamina of the inner plexiform later by P15. PMID: 18482716
  24. distribution of VGLUT3-ir structures in the lateral septum were systematically analyzed revealing PMID: 18611437
  25. A large number of retrogradely labeled cells in the caudal linear and interpeduncular nuclei projecting to the medial septum are found to contain VGLUT3. PMID: 18925658
  26. VGLUT3 is localized within neurons containing the NK1 receptor in several areas of the forebrain. PMID: 19699779

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Protein Families
Major facilitator superfamily, Sodium/anion cotransporter family, VGLUT subfamily
Tissue Specificity
Expressed in brain, kidney and liver. Expressed within the amygdala, brainstem, cerberal cortex, dorsal root ganglia, dorsal spinal cord, hippocampus, hypothalamus, retina, striatum and ventral spinal cord. Expressed within neurons of the caudate-putamen,
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*