Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PTPRZ1

Uniprot No.

P23471

Research Area

Neuroscience

Alternative Names

3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; Protein tyrosine phosphatase receptor type Z polypeptide 2; Protein tyrosine phosphatase, receptor type, Z polypeptide 1; Protein tyrosine phosphatase, receptor type, zeta polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; PTP-ZETA; PTP18; PTPRZ; PTPRZ_HUMAN; Ptprz1; PTPZ; R PTP zeta 2; R-PTP-zeta; R-PTP-zeta-2; Receptor type tyrosine phosphatase beta/zeta; Receptor-type tyrosine-protein phosphatase zeta; RPTP-BETA; RPTPB; RPTPbeta

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

36-300aa

Target Protein Sequence

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.1 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene fragment corresponding to the 36-300aa of the human PTPRZ1 protein was synthesized, with appropriate restriction sites suitable for in-frame cloning into an expression vector, with N-terminal 6xHis tag. The yeast was transfected with the expression vector, and the clone was expressed upon certain induction. After the induced cell centrifugation, the recombinant protein was purified from the cell extract and presented as N-terminal 6xHis-tagged fusion. This recombinant human PTPRZ1 protein's purity is greater than 90% assayed by SDS-PAGE. The PTPRZ1 protein ran to a band of about 28 kDa molecular weight on the gel.

PTPRZ1, as a member of the PTPR family, is a single-pass type I membrane protein with two cytoplasmic tyrosine phosphatase domains (D1 and D2), an alpha-carbonic anhydrase domain (CA), chondroitin sulfate proteoglycans (CS-PGs) and a fibronectin type-III domain (FNIII). Expression of PTPRZ1 restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Diseases associated with PTPRZ1 include generalized epilepsy with febrile seizures plus, Type 1 and oligodendroglioma. Among its related pathways are PAK pathway and spinal cord injury. It has been found that PTPRZ1 is highly expressed in SCLC cell lines and specifically exists in human NET tissues. PTPRZ1 also interacts with its ligand pleiotrophin (PTN), which is a secreted growth factor involved in angiogenesis and tumor growth.

Target Background

Function

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.

Gene References into Functions

Authors characterized exosomes from GBM cells harbouring and not harbouring PTPRZ1-MET fusion (ZM fusion). PMID: 28504721
PTPRZ1 is affected in a contiguous gene deletion syndrome PMID: 23570448
Confirm contribution of PTPRZ1, and especially PTPRQ, in CRC carcinogenesis and demonstrated that PTPRQ expression is correlated with KRAS mutation. PMID: 26851024
Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1). PMID: 25935522
Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET. PMID: 25135958
Distinct domains of PTPRZ-B are differentially required for migration and proliferation of glioma cells, respectively. PMID: 25238264
Protein tyrosine phosphatase zeta enhances proliferation by increasing beta-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells. PMID: 23588815
Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease. PMID: 23744080
PTPRZ1 was highly expressed in human neuroendocrine tumor tissues and PTPRZ1 is an oncogenic tyrosine phosphatase in small-cell lung carcinoma. PMID: 23170925
Receptor-type Protein tyrosine phosphatase beta regulates met phosphorylation and function in head and neck squamous cell carcinoma. PMID: 23226095
Studies indicate that RPTPzeta is an RPTP for which a link between ligand-dependent dimerization and inhibition of the intracellular tyrosine phosphatase activity has been clearly established. PMID: 22682003
Enhanced RPTPbeta/zeta signaling can contribute to schizophrenia phenotypes and support both construct and face validity for PTPRZ1-transgenic mice as a model for multiple schizophrenia phenotypes. PMID: 22832403
Loss of RPTPZ promotes prostate cancer metastasi. PMID: 23060448
The results of this study suggested that pleiotrophin inhibition of PTPRZ1 contributes to the homeostatic self-renewal of OPCs and that this process is mediated by the tonic activation of beta-catenin/TCF-dependent transcription. PMID: 23100427
report the cocrystal structure of the carbonic anhydrase-like domain of PTPRZ bound to tandem Ig repeats of CNTN1 and binding assays to show that PTPRZ binds specifically to CNTN1 expressed at the surface of oligodendrocyte precursor cells PMID: 21969550
molecular basis for the substrate recognition of Ptprz. PMID: 21890632
RPTP-beta is a key regulator of Met function. PMID: 21454675
preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region PMID: 20224786
PTPRZ1 has a role in oligodendrocyte survival and in recovery from demyelinating disease PMID: 12355066
RPTPzeta has a novel role in regulating glioblastoma cell motility PMID: 14555979
In AZ-521 cells, which mainly express RPTPbeta, VacA, after binding to RPTPbeta in non-lipid raft microdomains on the cell surface, is localized with RPTPbeta in lipid rafts in a temperature- and VacA concentration-dependent process. PMID: 17030583
Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen PMID: 17368428
the PTN/RPTPbeta/zeta signaling pathway may be constitutively activated and potentially function to constitutively activate ALK in human breast cancer PMID: 17706593
the effect of the shorter basic peptide P(122-131) on DU145 cells, which express HARP and its receptor RPTPB, suggested interference, under anchorage-independent conditions, of P(122-131) with a HARP autocrine loop in an RPTPB -dependent fashion. PMID: 17727841
Pleiotrophin receptor (PTPRZ1) is expressed in embryonic stem cells and mediates important signals for survival, proliferation, and maintenance of pluripotency state. PMID: 17823238
results from the immunohistochemical analyses of rPTPbeta/zeta expression should prompt further evaluation of this protein as a novel oligodendroglioma marker. PMID: 18003890
PTPRZ1 is unlikely to be related to the development of schizophrenia in the Japanese population PMID: 18186075
the cleavage sites in the extracellular juxtamembrane region of Ptprz by tumor necrosis factor-alpha converting enzyme and matrix metalloproteinase 9. PMID: 18713734
GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface. PMID: 18838383
these data suggest that alpha(v)beta(3) is a key molecule that determines the stimulatory or inhibitory effect of pleiotrophin on cell migration. PMID: 19141530
phosphacan was present in the evolving astroglial scar after human traumatic spinal cord injury, and, therefore, might play an important role in the blockade of successful CNS regeneration. PMID: 19604403

Hide All

Subcellular Location

[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted.

Protein Families

Protein-tyrosine phosphatase family, Receptor class 5 subfamily

Tissue Specificity

Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.

Database Links

HGNC: 9685

OMIM: 176891

KEGG: hsa:5803

STRING: 9606.ENSP00000377047

UniGene: Hs.489824

Code	CSB-YP019068HU
Abbreviation	Recombinant Human PTPRZ1 protein, partial
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP019068HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PTPRZ1. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP019068HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PTPRZ1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage