Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial

Code CSB-EP019068HU
Abbreviation Recombinant Human PTPRZ1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; Protein tyrosine phosphatase receptor type Z polypeptide 2; Protein tyrosine phosphatase, receptor type, Z polypeptide 1; Protein tyrosine phosphatase, receptor type, zeta polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; PTP-ZETA; PTP18; PTPRZ; PTPRZ_HUMAN; Ptprz1; PTPZ; R PTP zeta 2; R-PTP-zeta; R-PTP-zeta-2; Receptor type tyrosine phosphatase beta/zeta; Receptor-type tyrosine-protein phosphatase zeta; RPTP-BETA; RPTPB; RPTPbeta
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
36-300aa
Target Protein Sequence
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.1kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.
Gene References into Functions
  1. Authors characterized exosomes from GBM cells harbouring and not harbouring PTPRZ1-MET fusion (ZM fusion). PMID: 28504721
  2. PTPRZ1 is affected in a contiguous gene deletion syndrome PMID: 23570448
  3. Confirm contribution of PTPRZ1, and especially PTPRQ, in CRC carcinogenesis and demonstrated that PTPRQ expression is correlated with KRAS mutation. PMID: 26851024
  4. Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1). PMID: 25935522
  5. Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET. PMID: 25135958
  6. Distinct domains of PTPRZ-B are differentially required for migration and proliferation of glioma cells, respectively. PMID: 25238264
  7. Protein tyrosine phosphatase zeta enhances proliferation by increasing beta-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells. PMID: 23588815
  8. Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease. PMID: 23744080
  9. PTPRZ1 was highly expressed in human neuroendocrine tumor tissues and PTPRZ1 is an oncogenic tyrosine phosphatase in small-cell lung carcinoma. PMID: 23170925
  10. Receptor-type Protein tyrosine phosphatase beta regulates met phosphorylation and function in head and neck squamous cell carcinoma. PMID: 23226095
  11. Studies indicate that RPTPzeta is an RPTP for which a link between ligand-dependent dimerization and inhibition of the intracellular tyrosine phosphatase activity has been clearly established. PMID: 22682003
  12. Enhanced RPTPbeta/zeta signaling can contribute to schizophrenia phenotypes and support both construct and face validity for PTPRZ1-transgenic mice as a model for multiple schizophrenia phenotypes. PMID: 22832403
  13. Loss of RPTPZ promotes prostate cancer metastasi. PMID: 23060448
  14. The results of this study suggested that pleiotrophin inhibition of PTPRZ1 contributes to the homeostatic self-renewal of OPCs and that this process is mediated by the tonic activation of beta-catenin/TCF-dependent transcription. PMID: 23100427
  15. report the cocrystal structure of the carbonic anhydrase-like domain of PTPRZ bound to tandem Ig repeats of CNTN1 and binding assays to show that PTPRZ binds specifically to CNTN1 expressed at the surface of oligodendrocyte precursor cells PMID: 21969550
  16. molecular basis for the substrate recognition of Ptprz. PMID: 21890632
  17. RPTP-beta is a key regulator of Met function. PMID: 21454675
  18. preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region PMID: 20224786
  19. PTPRZ1 has a role in oligodendrocyte survival and in recovery from demyelinating disease PMID: 12355066
  20. RPTPzeta has a novel role in regulating glioblastoma cell motility PMID: 14555979
  21. In AZ-521 cells, which mainly express RPTPbeta, VacA, after binding to RPTPbeta in non-lipid raft microdomains on the cell surface, is localized with RPTPbeta in lipid rafts in a temperature- and VacA concentration-dependent process. PMID: 17030583
  22. Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen PMID: 17368428
  23. the PTN/RPTPbeta/zeta signaling pathway may be constitutively activated and potentially function to constitutively activate ALK in human breast cancer PMID: 17706593
  24. the effect of the shorter basic peptide P(122-131) on DU145 cells, which express HARP and its receptor RPTPB, suggested interference, under anchorage-independent conditions, of P(122-131) with a HARP autocrine loop in an RPTPB -dependent fashion. PMID: 17727841
  25. Pleiotrophin receptor (PTPRZ1) is expressed in embryonic stem cells and mediates important signals for survival, proliferation, and maintenance of pluripotency state. PMID: 17823238
  26. results from the immunohistochemical analyses of rPTPbeta/zeta expression should prompt further evaluation of this protein as a novel oligodendroglioma marker. PMID: 18003890
  27. PTPRZ1 is unlikely to be related to the development of schizophrenia in the Japanese population PMID: 18186075
  28. the cleavage sites in the extracellular juxtamembrane region of Ptprz by tumor necrosis factor-alpha converting enzyme and matrix metalloproteinase 9. PMID: 18713734
  29. GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface. PMID: 18838383
  30. these data suggest that alpha(v)beta(3) is a key molecule that determines the stimulatory or inhibitory effect of pleiotrophin on cell migration. PMID: 19141530
  31. phosphacan was present in the evolving astroglial scar after human traumatic spinal cord injury, and, therefore, might play an important role in the blockade of successful CNS regeneration. PMID: 19604403

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted.
Protein Families
Protein-tyrosine phosphatase family, Receptor class 5 subfamily
Tissue Specificity
Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.
Database Links

HGNC: 9685

OMIM: 176891

KEGG: hsa:5803

STRING: 9606.ENSP00000377047

UniGene: Hs.489824

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*