Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

In Stock
Code CSB-EP867765RMS
Abbreviation Recombinant Rickettsia conorii ompB protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ompB
Uniprot No.
Research Area
Others
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Source
E.coli
Expression Region
1363-1655aa
Target Protein Sequence
GDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rickettsia conorii Outer membrane protein B (ompB) is expressed in E. coli, covering the 1363-1655 amino acid region of the protein. This partial protein carries a C-terminal 6xHis-tag, which helps with purification and detection. The product achieves a high purity level of over 90%, as confirmed by SDS-PAGE analysis. This purity appears sufficient for precise research applications.

Outer membrane protein B (ompB) from Rickettsia conorii plays a crucial role in the bacterial outer membrane structure. It seems to be involved in the infection process and represents a key target for studying Rickettsia pathogenesis. Researchers work with ompB to investigate host-pathogen interactions and understand the mechanisms of bacterial adhesion and invasion. This protein is likely integral to advancing research in microbial pathogenesis and infectious diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Rickettsia conorii ompB fragment is expressed in E. coli, a prokaryotic system that is generally suitable for producing bacterial outer membrane proteins. As both Rickettsia and E. coli are prokaryotes, the protein has a reasonable probability of proper folding. The expressed fragment (1363-1655aa, 292 amino acids) represents a partial C-terminal region of ompB with a C-terminal 6xHis tag and >90% purity. However, outer membrane proteins require specific folding pathways and often need proper membrane integration for full functionality. The C-terminal His-tag may interfere with the native protein structure, particularly if this region is important for membrane anchoring or protein-protein interactions. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its structural integrity and potential function.

1. Antibody Development and Validation Studies

This recombinant OmpB fragment is suitable for use as an immunogen to generate antibodies specific to this region of R. conorii OmpB. The His-tag facilitates purification and screening. However, it is critical to note that the antibodies generated will be against the linear epitopes of this non-native, likely misfolded fragment. Their ability to recognize the correctly folded, full-length OmpB protein in the outer membrane of R. conoriiis uncertain and must be empirically validated. These antibodies are primarily tools for detecting the denatured protein in techniques like Western blotting.

2. Protein-Protein Interaction Studies Using His-Tag Affinity

This application requires caution. While the His-tag enables technical feasibility for pull-down assays, if the ompB fragment is misfolded or improperly structured, it may not interact physiologically with true binding partners. Outer membrane proteins require precise conformation for specific interactions. This application should only be pursued after confirming proper folding through biophysical characterization.

3. ELISA-Based Binding Assays

This application is feasible for technical development but has limitations for functional studies. The His-tag enables ELISA format development, but if ompB is misfolded, binding studies may not reflect biological reality. The assay may work for antibody detection, but requires validation against properly folded ompB for accurate biological interaction studies.

4. Biochemical Characterization and Stability Studies

This purified recombinant ompB protein is well-suited for basic biochemical and biophysical characterization. Researchers can analyze its thermal stability, aggregation state, and solution behavior using techniques like dynamic light scattering and differential scanning calorimetry. This application is valid and independent of the protein's native bioactivity, as it focuses on the intrinsic physical properties of the purified polypeptide itself.

Final Recommendation & Action Plan

Given that ompB is a bacterial protein expressed in a prokaryotic system, but as a partial fragment with a tag, recommend first performing validation studies: 1) Biophysical characterization (circular dichroism for secondary structure, analytical size-exclusion chromatography for oligomeric state) to assess folding quality; 2) If possible, comparison with full-length ompB or native protein from R. conorii; 3) Functional validation of membrane binding or interaction properties if applicable. Antibody development can proceed as the safest application. Avoid functional interaction studies until proper folding is confirmed. For reliable ompB research, include appropriate controls such as known binding partners when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The 120 kDa surface-exposed protein is a major structural protein which may play a role as a rickettsial virulence factor and/or immunogen during infection.; The 32 kDa beta peptide may serve as a membrane anchor. It has been shown to adhere to biotinylated Vero cell proteins.
Gene References into Functions
  1. Rickettsial outer-membrane protein B (rOmpB) mediates bacterial invasion through Ku70 in an actin, c-Cbl, clathrin and caveolin 2-dependent manner. PMID: 19134120
  2. One bacterial adhesion was identified as the C-terminal extremity of rOmpB called the beta-peptide by proteomic analysis PMID: 16574381
Subcellular Location
[Outer membrane protein B]: Periplasm.; [120 kDa surface-exposed protein]: Secreted. Cell surface.; [32 kDa beta peptide]: Cell outer membrane; Multi-pass membrane protein. Note=The cleaved C-terminal fragment (autotransporter domain) is localized in the outer membrane.
Protein Families
Rickettsiae OmpA/OmpB family
Database Links

KEGG: rco:RC1085

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*