Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
RC0497; Putative N-acetylmuramoyl-L-alanine amidase RC0497; EC 3.5.1.28
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Expression Region
1-267aa
Target Protein Sequence
MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Rickettsia conorii RC0497 was expressed with the amino acid range of 1-267. This RC0497 protein is theoretically predicted to have a molecular weight of 45.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of RC0497, making it easier to detect and purify the RC0497 recombinant protein in the later stages of expression and purification.
Rickettsia conorii putative N-acetylmuramoyl-L-alanine amidase RC0497 functions as a crucial enzyme in bacterial cell wall metabolism, specifically involved in peptidoglycan cleavage. Its primary function contributes to bacterial division and structural integrity. In microbiology and infectious disease research, studying RC0497 provides insights into Rickettsia conorii cell biology, pathogenicity, and potential vulnerabilities for therapeutic interventions. RC0497's role in bacterial cell wall remodeling makes it relevant in antibiotic resistance studies. Investigating RC0497 spans diverse research areas, contributing to a deeper understanding of bacterial physiology and opening avenues for developing novel antibacterial strategies, particularly in addressing challenges associated with Rickettsia infections and emerging antibiotic-resistant bacteria.
