Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RC0497

Uniprot No.

Q92IC3

Research Area

Others

Alternative Names

RC0497; Putative N-acetylmuramoyl-L-alanine amidase RC0497; EC 3.5.1.28

Species

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Source

E.coli

Expression Region

1-267aa

Target Protein Sequence

MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

45.6kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Rickettsia conorii RC0497 was expressed with the amino acid range of 1-267. This RC0497 protein is theoretically predicted to have a molecular weight of 45.6 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of RC0497, making it easier to detect and purify the RC0497 recombinant protein in the later stages of expression and purification.

Rickettsia conorii putative N-acetylmuramoyl-L-alanine amidase RC0497 functions as a crucial enzyme in bacterial cell wall metabolism, specifically involved in peptidoglycan cleavage. Its primary function contributes to bacterial division and structural integrity. In microbiology and infectious disease research, studying RC0497 provides insights into Rickettsia conorii cell biology, pathogenicity, and potential vulnerabilities for therapeutic interventions. RC0497's role in bacterial cell wall remodeling makes it relevant in antibiotic resistance studies. Investigating RC0497 spans diverse research areas, contributing to a deeper understanding of bacterial physiology and opening avenues for developing novel antibacterial strategies, particularly in addressing challenges associated with Rickettsia infections and emerging antibiotic-resistant bacteria.

Code	CSB-EP849886RMS
Abbreviation	Recombinant Rickettsia conorii RC0497 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rickettsia conorii Putative N-acetylmuramoyl-L-alanine amidase RC0497 (RC0497)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage