Recombinant Saccharomyces cerevisiae Nicotinamidase (PNC1)

In Stock
Code CSB-EP346834SVG
Abbreviation Recombinant Saccharomyces cerevisiae PNC1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
PNC1
Uniprot No.
Research Area
Microbiology
Alternative Names
PNC1; YGL037C; Nicotinamidase; EC 3.5.1.19; Nicotinamide deamidase; NAMase
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
1-216aa
Target Protein Sequence
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Saccharomycerevisiae Nicotinamidase (PNC1) is expressed in E. coli and spans the complete protein sequence from amino acids 1 to 216. An N-terminal 6xHis-tag is attached to make purification and detection more straightforward. SDS-PAGE analysis shows the protein reaches greater than 90% purity, which appears to meet the standards needed for most research work.

Nicotinamidase—called PNC1 in Saccharomyces cerevisiae—seems to play an important role in the NAD+ salvage pathway. It converts nicotinamide to nicotinic acid. This conversion is likely essential for keeping cellular NAD+ levels stable, and these levels matter for numerous metabolic processes. Studies with nicotinamidase may offer insights into how cells handle metabolism and stress responses in yeast and possibly other organisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Saccharomyces cerevisiae PNC1 is expressed in E. coli, a prokaryotic system that is generally suitable for producing soluble enzymatic proteins like nicotinamidase. PNC1 is a relatively small (216aa) metabolic enzyme that catalyzes the conversion of nicotinamide to nicotinic acid. While E. coli can often properly fold such enzymes, the eukaryotic origin of PNC1 and potential post-translational modifications may present folding challenges. The protein is full-length (1-216aa) with an N-terminal 6xHis tag and >90% purity. However, since activity is explicitly unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its enzymatic activity using nicotinamide as a substrate.

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The N-terminal 6xHis tag enables technical feasibility for pull-down assays. However, if PNC1 is misfolded (a possibility in E. coli for a eukaryotic enzyme), it may not interact physiologically with true binding partners. Identified interactions could be non-physiological artifacts. This application should only be pursued after confirming proper folding and enzymatic activity.

2. Antibody Development and Validation

The recombinant PNC1 can serve as an effective immunogen for generating antibodies that recognize linear epitopes, even if the protein is misfolded. The high purity supports immunization protocols. However, antibodies may not recognize conformational epitopes of properly folded, native PNC1 in yeast cells.

3. Comparative Protein Structure and Stability Analysis

This application is well-suited for assessing the recombinant Saccharomyces cerevisiae PNC1 itself. Techniques like circular dichroism spectroscopy, thermal shift assays, and dynamic light scattering can evaluate the protein's folding state and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant Saccharomyces cerevisiae PNC1.

4. Substrate Specificity and Inhibitor Screening Assays

This application is highly dependent on correct folding and activity. If PNC1 is misfolded, substrate specificity studies and inhibitor screening will yield invalid results. These functional applications require prior validation of proper folding and demonstration of nicotinamidase activity.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, recommend first validating the protein's enzymatic activity using a standard nicotinamidase assay with nicotinamide as substrate. Perform basic biophysical characterization (size-exclusion chromatography, circular dichroism) to assess folding quality. Antibody development can proceed as the lowest-risk application. Avoid all functional studies (interactions, kinetics, screening) until proper folding and activity are confirmed. For reliable PNC1 functional studies, consider including appropriate controls such as known substrates and validated inhibitors in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Gene References into Functions
  1. Enhanced resistance was also independent of the nicotinamide salvage pathway, which uses nicotinamide as a substrate to generate NAD+, and of a DNA damage-induced increase in the salvage enzyme Pnc1 PMID: 27527516
  2. In this paper, the catalytic mechanism of Pnc1 has been investigated by using a combined quantum-mechanical/molecular-mechanical (QM/MM) approach based on the recently obtained crystal structure of Pnc1. PMID: 24413890
  3. The overall kinetic mechanism of eukaryotic nicotinamidase from S. cerevisiae (Pnc1) is established through product inhibition analysis, also demonstrating that nicotinamide analogues are Pnc1 inhibitors. PMID: 22229411
  4. Crystal structure reveals extended helical arrays interwoven to form an unusually robust, yet porous superstructure. PMID: 17382284
  5. Exogenous nicotinamide can therefore have negative or positive impacts on rDNA silencing, depending on the PNC1 expression level. PMID: 18780747
  6. overall data showed that PNC1 is a biomarker of mRNA mistranslation and protein misfolding and that PNC1-GFP fusions can be used to monitor these two important biological phenomena in vivo PMID: 19381334

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Peroxisome.
Protein Families
Isochorismatase family
Database Links

KEGG: sce:YGL037C

STRING: 4932.YGL037C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*