Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)


In Stock
Code CSB-EP346834SVGe1
Product Type Recombinant Protein
Size US$2632Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P53184
Lead Time 3-7 business days
Relevance Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Nicotinamide deamidase
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Research Area Microbiology
Source E.coli
Gene Names PNC1
Expression Region 1-216aa
Tag Info Tag-Free
Mol. Weight 25.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
Subcellular Location Cytoplasm, Nucleus, Peroxisome
Protein Families Isochorismatase family
Database Links

KEGG: sce:YGL037C

STRING: 4932.YGL037C

Related Products

PNC1 Antibodies

PNC1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

PNC1 Proteins

PNC1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.