Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP346834SVGe1 |
| Product Type | Recombinant Protein |
| Size |
US$2632Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P53184 |
| Lead Time | 3-7 business days |
| Relevance | Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Nicotinamide deamidase |
| Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK |
| Research Area | Microbiology |
| Source | E.coli |
| Gene Names | PNC1 |
| Expression Region | 1-216aa |
| Tag Info | Tag-Free |
| Mol. Weight | 25.0kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Catalyzes the deamidation of nicotinamide, an early step in the NAD(+) salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. |
| Subcellular Location | Cytoplasm, Nucleus, Peroxisome |
| Protein Families | Isochorismatase family |
| Database Links |
KEGG: sce:YGL037C STRING: 4932.YGL037C |
PNC1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA346834ZA01SVG | PNC1 Antibody | Saccharomyces cerevisiae | ELISA, WB (ensure identification of antigen) |
| CSB-PA346834ZA01SVG | PNC1 Antibody | Saccharomyces cerevisiae | ELISA, WB (ensure identification of antigen) |
| CSB-PA346834XA01SVG | PNC1 Antibody | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) | ELISA, WB (ensure identification of antigen) |
PNC1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP346834SVG CSB-BP346834SVG CSB-MP346834SVG |
Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1) | Yeast Baculovirus Mammalian cell |
| CSB-EP346834SVG | Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1) | E.coli |
Recombinant Mouse Microtubule-associated protein tau(Mapt)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Fibroblast growth factor receptor 3(FGFR3),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Replication factor C subunit 1(RFC1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Methionine aminopeptidase 2(METAP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)
Express system: Yeast
Species: Homo sapiens (Human)
-AC.jpg)
Recombinant Human Aquaporin-1(AQP1) (Active)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
