Recombinant Saccharomyces cerevisiae ProlifeRating cell nuclear antigen (POL30)

Code CSB-YP017621SVG
Abbreviation Recombinant Saccharomyces cerevisiae POL30 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
POL30
Uniprot No.
Research Area
Microbiology
Alternative Names
POL30; YBR088C; YBR0811; Proliferating cell nuclear antigen; PCNA
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
Yeast
Expression Region
1-258aa
Target Protein Sequence
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Gene References into Functions
  1. proliferating cell nuclear antigen (PCNA) unloading activity of Elg1 is important for coordinating DNA replication forks with the process of replication-coupled nucleosome assembly to maintain silencing of HML and HMR through S-phase PMID: 29440488
  2. found evidence implicating PCNA in the maintenance of the high-order structure and stability of heterochromatin, which indicates a role of DNA replication in heterochromatin maintenance PMID: 27987109
  3. Srs2 interaction with PCNA allows the helicase activity to unwind fork-blocking CAG/CTG hairpin structures to prevent DNA breaks during DNA replication. Independently of PCNA binding, Srs2 also displaces Rad51 from nascent strands to prevent recombination-dependent repeat expansions and contractions. PMID: 28175398
  4. the various roles of Elg1 in genome stability maintenance involve the unloading of both modified and unmodified PCNA. PMID: 28108661
  5. Pro-recombination Role of Srs2 Protein Requires SUMO (Small Ubiquitin-like Modifier) but Is Independent of PCNA (Proliferating Cell Nuclear Antigen) Interaction. PMID: 26861880
  6. results suggest that Elg1-RLC acts as a general PCNA unloader and is dependent upon DNA ligation during chromosome replication. PMID: 26212319
  7. Elevated levels of PCNA rescue pds5-1 temperature sensitivity and cohesion defects, but do not rescue pds5-1 mutant cell condensation defects. PMID: 25986377
  8. Authors discuss the interplay of POL30 and Srs2 proteins in error-free DNA-damage tolerance in Saccharomyces cerevisiae and show how sumoylated PCNA recruits Srs2 for this mechanism. [Review] PMID: 26041265
  9. In contrast to the "toolbelt" model, which was demonstrated for bacterial and archaeal sliding clamps, our results suggest a mechanism of sequential switching of partners on the eukaryotic PCNA trimer during DNA replication and repair. PMID: 25228764
  10. Cells deficient in PCNA unloading exhibit increased chromosome breaks. PMID: 25449133
  11. Data indicate that the C22Y substitution alters the positions of the alpha-helices lining the central hole of the POL30 (PCNA) ring, whereas the C81R substitution creates a distortion in an extended loop near the PCNA subunit interface. PMID: 23869605
  12. Elg1-replication factor C-like complex functions in unloading of both unmodified and SUMOylated PCNA during DNA replication. PMID: 23499004
  13. The increased dynamics of hPCNA relative to scPCNA may allow it to acquire multiple induced conformations upon binding to its substrates enlarging its binding diversity. PMID: 21364740
  14. show that yeast Elg1 interacts physically and genetically with PCNA, in a manner that depends on PCNA modification, and exhibits preferential affinity for SUMOylated PCNA. PMID: 20571511
  15. High-copy expression of POL30 (PCNA) suppresses the canavanine mutation rate of all the rad27 alleles, including rad27Delta. PMID: 19596905
  16. SUMO-modified PCNA functionally cooperates with Srs2 PMID: 15931174
  17. Crosstalk between SUMO and ubiquitin on PCNA is mediated by recruitment of the helicase SRs2p. PMID: 15989970
  18. Mediates the entry of the flap endonuclease and DNA ligase I into the process of Okazaki fragment joining, and this ordered entry is necessary to prevent CAG repeat tract expansions. PMID: 16079237
  19. PCNA acts as a scaffold for consecutive protein-protein interactions that allow for the coordination of mismatch repair steps. PMID: 16303135
  20. An open PCNA clamp in a complex with RFC through fluorescence energy transfer experiments was captured. PMID: 16476998
  21. Diubiquitinated Mcm10 interacts with PCNA to facilitate an essential step in DNA elongation. PMID: 16782870
  22. Mgs1 physically associates with PCNA and that Mgs1 helps suppress the RAD6 DNA damage tolerance pathway in the absence of exogenous DNA damage. PMID: 16809783
  23. role for PCNA in regulating the mutagenic activity of Polzeta separate from its modification at Lys164 PMID: 16957771
  24. The loaded form of yPCNA may play an important effector role in directing yMutLalpha incision to the discontinuous strand of a nicked heteroduplex. PMID: 17951253
  25. Mismatch repair-PCNA interactions are important for repairing mismatches formed during meiotic recombination, but play only a relatively minor role in regulating the fidelity of mitotic recombination. PMID: 18245822
  26. PCNA participates in formation and stability of epigenetically regulated chromatin through a pathway that includes replication factor C, the chromatin assembly factor Asf1p, and the K56-specific acetyltransferase Rtt109p. PMID: 18558650
  27. PCNA modification by SUMO is controlled by DNA PMID: 18701921
  28. the balance between HDR and NHEJ pathways is crucially controlled by genes of the RAD6 pathway through modifications of PCNA PMID: 18722556
  29. While wild-type PCNA stimulates incorporation by Dna polymerase eta opposite an abasic site, the mutant PCNA protein actually inhibits incorporation opposite this DNA lesion. PMID: 19053247
  30. Data suggest that mono-ubiquitination of PCNA is induced by nucleotide misincorporation by DNA polymerase alpha. PMID: 19279190
  31. DNA binding commits Saccharomyces cerevisiae replication factor C to ATP hydrolysis, which is followed by proliferating cell nuclear antigen (PCNA) closure and PCNA.DNA release. PMID: 19285992

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
PCNA family
Database Links

KEGG: sce:YBR088C

STRING: 4932.YBR088C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*