Recombinant Salmonella typhimurium Invasion protein iagB(iagB)

Code CSB-EP315647SXB
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0CL15
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
Research Area Others
Source E.coli
Gene Names iagB
Expression Region 20-160aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 32.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

iagB Antibodies

iagB Antibodies for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

iagB Proteins

iagB Proteins for Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.