Home
Protein
Recombinant Proteins
Recombinant Schistosoma japonicum 23 kDa integral membrane protein, partial

Recombinant Schistosoma japonicum 23 kDa integral membrane protein, partial

Code	CSB-YP326733SXP1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP326733SXP1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP326733SXP1-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP326733SXP1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP326733SXP1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Uniprot No.

P27591

Alternative Names

23 kDa integral membrane protein; Sj23

Species

Schistosoma japonicum (Blood fluke)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I'm intersted in CSB-EP326733SXP1 and my concerns and requests:
I had revisions with my materials and methods. I would like to know if you can quote me for the 8.5 kDa part of extracellular domain II of Sj23 at 1 mg, E. coli expression host. PHilippine strain is preferred, but not required.
Also, may I know what other proteins from Schistosoma japonicum can you clone? I prefer tegument proteins or excretory/secretory proteins from the larval stage of the parasite (cercaria). How much is it at 1 mg?”

Thanks for your inquiry.
Recombinant Schistosoma japonicum 23 kDa integral membrane protein,partial
CSB-EP326733SXP1 >> E.coli
Expression Region: 109-183aa; Partial.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

KDKIDDEINTLMTGALENPNEEITATMDKIQTSFHCCGVKGPDDYKGNVPASCKEGQEVYVQGCLSVFSAFLKRN

As to the 8.5 kDa part of extracellular domain II of Sj23, do you refer to the region of 109-183aa?
In addition, according to your description that I prefer tegument proteins or excretory/secretory proteins from the larval stage of the parasite (cercaria),
We think you may need the native protein, if so, sorry, we can't provide this native protein.