Recombinant Schizosaccharomyces pombe Probable U3 small nucleolar RNA-associated protein 11(SPAC18G6.06)

Product Type Recombinant Protein
Uniprot No. Q10106
Abbreviation SPAC18G6.06
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Gene Names utp11
Protein Names Recommended name: Probable U3 small nucleolar RNA-associated protein 11 Short name= U3 snoRNA-associated protein 11
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Function Involved in nucleolar processing of pre-18S ribosomal RNA.
Subcellular Location Nucleus, nucleolus
Protein Families UTP11 family
Database Links

KEGG: spo:SPAC18G6.06

STRING: 4896.SPAC18G6.06.1

Product Details for Different Expression Systems

Product Name Recombinant Schizosaccharomyces pombe Probable U3 small nucleolar RNA-associated protein 11(SPAC18G6.06),Yeast
Code CSB-YP604555SXV
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSSSFKNAGQRKNHRERAQPFERRKWGLLEKRKDYAQRAQDYKTKQKKLKRLREKALERN PDEFYHEMTHKKTKNGVPLEQREDSTIDMDTIKILKTQDIGWIRHHRNVERAKIDHLEQQ MHTVGAHRNKNESRKHTIFVDNVKEAKSFNPAEFFQTTDDLVGRTENRVKKDQIENNELT NQPFSGKLHSKLKEKAATELLLRQKRDKKLAAAEERVELDRLLQGKGGRQKKKVVNGKPV YKWRNERKR
Expression Region 1-249
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Probable U3 small nucleolar RNA-associated protein 11(SPAC18G6.06),E.coli
Code CSB-EP604555SXV
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSSSFKNAGQRKNHRERAQPFERRKWGLLEKRKDYAQRAQDYKTKQKKLKRLREKALERN PDEFYHEMTHKKTKNGVPLEQREDSTIDMDTIKILKTQDIGWIRHHRNVERAKIDHLEQQ MHTVGAHRNKNESRKHTIFVDNVKEAKSFNPAEFFQTTDDLVGRTENRVKKDQIENNELT NQPFSGKLHSKLKEKAATELLLRQKRDKKLAAAEERVELDRLLQGKGGRQKKKVVNGKPV YKWRNERKR
Expression Region 1-249
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Probable U3 small nucleolar RNA-associated protein 11(SPAC18G6.06),Baculovirus
Code CSB-BP604555SXV
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSSSFKNAGQRKNHRERAQPFERRKWGLLEKRKDYAQRAQDYKTKQKKLKRLREKALERN PDEFYHEMTHKKTKNGVPLEQREDSTIDMDTIKILKTQDIGWIRHHRNVERAKIDHLEQQ MHTVGAHRNKNESRKHTIFVDNVKEAKSFNPAEFFQTTDDLVGRTENRVKKDQIENNELT NQPFSGKLHSKLKEKAATELLLRQKRDKKLAAAEERVELDRLLQGKGGRQKKKVVNGKPV YKWRNERKR
Expression Region 1-249
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Probable U3 small nucleolar RNA-associated protein 11(SPAC18G6.06),Mammalian cell
Code CSB-MP604555SXV
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSSSFKNAGQRKNHRERAQPFERRKWGLLEKRKDYAQRAQDYKTKQKKLKRLREKALERN PDEFYHEMTHKKTKNGVPLEQREDSTIDMDTIKILKTQDIGWIRHHRNVERAKIDHLEQQ MHTVGAHRNKNESRKHTIFVDNVKEAKSFNPAEFFQTTDDLVGRTENRVKKDQIENNELT NQPFSGKLHSKLKEKAATELLLRQKRDKKLAAAEERVELDRLLQGKGGRQKKKVVNGKPV YKWRNERKR
Expression Region 1-249
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

utp11 Antibodies

utp11 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.