Recombinant Schizosaccharomyces pombe Uncharacterized protein C17C9.15c(SPAC17C9.15c)

Product Type Recombinant Protein
Uniprot No. Q10486
Abbreviation SPAC17C9.15c
Species Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Gene Names SPAC17C9.15c
Protein Names Recommended name: Uncharacterized protein C17C9.15c
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Product Details for Different Expression Systems

Product Name Recombinant Schizosaccharomyces pombe Uncharacterized protein C17C9.15c(SPAC17C9.15c),Yeast
Code CSB-YP604611SXV
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSDSFHYQYDRASPERLKPTIYSWTRLRQSTRAQNENEQAKRRQGILEHKRGGSMEMNKF IDESAYMEWEKQLENASEDYAIEPSDLEEEVDQL
Expression Region 1-94
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Uncharacterized protein C17C9.15c(SPAC17C9.15c),E.coli
Code CSB-EP604611SXV
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSDSFHYQYDRASPERLKPTIYSWTRLRQSTRAQNENEQAKRRQGILEHKRGGSMEMNKF IDESAYMEWEKQLENASEDYAIEPSDLEEEVDQL
Expression Region 1-94
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Uncharacterized protein C17C9.15c(SPAC17C9.15c),Baculovirus
Code CSB-BP604611SXV
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSDSFHYQYDRASPERLKPTIYSWTRLRQSTRAQNENEQAKRRQGILEHKRGGSMEMNKF IDESAYMEWEKQLENASEDYAIEPSDLEEEVDQL
Expression Region 1-94
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Schizosaccharomyces pombe Uncharacterized protein C17C9.15c(SPAC17C9.15c),Mammalian cell
Code CSB-MP604611SXV
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSDSFHYQYDRASPERLKPTIYSWTRLRQSTRAQNENEQAKRRQGILEHKRGGSMEMNKF IDESAYMEWEKQLENASEDYAIEPSDLEEEVDQL
Expression Region 1-94
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

SPAC17C9.15c Antibodies

SPAC17C9.15c Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.