Recombinant Serpentine receptor class alpha-34(sra-34)

Product Type Recombinant Protein
Uniprot No. Q10936
Abbreviation sra-34
Species Caenorhabditis elegans
Gene Names sra-34
Protein Names Recommended name: Serpentine receptor class alpha-34 Short name= Protein sra-34
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Nematode receptor-like protein sra family
Database Links

KEGG: cel:CELE_B0304.7

UniGene: Cel.25452

Product Details for Different Expression Systems

Product Name Recombinant Serpentine receptor class alpha-34(sra-34),Yeast
Code CSB-YP604650CXY
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MNVSTPGFQRCATENEMIGRTAFLFQSNVYTNNIIAIITWTLTVVVLRKLYTKSIFPNST LVLLVASLAVGSIHEFLYGFIQNWSLLRSLVYWDQPCKIMFNEYECYPFYTANIFIRLLM ICTNCAITIDRLITLSNVGIKSTAQRGIVLFILSILVSVGVCMYMTSDGPNDNLQSNCFQ RQGRNIDELTTQIMIYLYIIAICLSLNTIGWFISWRNLKKDKFNLAVQMSKQESINSSLV VTWYLVSQIIFLGLYSILIYAVIKLKDVIGPLLVTNVVLWCYTYTYACMFLPIIILTSTK IISLQRREKINGLTKENQNENQKSYFDKLDRSWSQGYGNRYAPNVPAPVVCINSS
Expression Region 1-355
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Serpentine receptor class alpha-34(sra-34),E.coli
Code CSB-EP604650CXY
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MNVSTPGFQRCATENEMIGRTAFLFQSNVYTNNIIAIITWTLTVVVLRKLYTKSIFPNST LVLLVASLAVGSIHEFLYGFIQNWSLLRSLVYWDQPCKIMFNEYECYPFYTANIFIRLLM ICTNCAITIDRLITLSNVGIKSTAQRGIVLFILSILVSVGVCMYMTSDGPNDNLQSNCFQ RQGRNIDELTTQIMIYLYIIAICLSLNTIGWFISWRNLKKDKFNLAVQMSKQESINSSLV VTWYLVSQIIFLGLYSILIYAVIKLKDVIGPLLVTNVVLWCYTYTYACMFLPIIILTSTK IISLQRREKINGLTKENQNENQKSYFDKLDRSWSQGYGNRYAPNVPAPVVCINSS
Expression Region 1-355
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Serpentine receptor class alpha-34(sra-34),Baculovirus
Code CSB-BP604650CXY
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MNVSTPGFQRCATENEMIGRTAFLFQSNVYTNNIIAIITWTLTVVVLRKLYTKSIFPNST LVLLVASLAVGSIHEFLYGFIQNWSLLRSLVYWDQPCKIMFNEYECYPFYTANIFIRLLM ICTNCAITIDRLITLSNVGIKSTAQRGIVLFILSILVSVGVCMYMTSDGPNDNLQSNCFQ RQGRNIDELTTQIMIYLYIIAICLSLNTIGWFISWRNLKKDKFNLAVQMSKQESINSSLV VTWYLVSQIIFLGLYSILIYAVIKLKDVIGPLLVTNVVLWCYTYTYACMFLPIIILTSTK IISLQRREKINGLTKENQNENQKSYFDKLDRSWSQGYGNRYAPNVPAPVVCINSS
Expression Region 1-355
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Serpentine receptor class alpha-34(sra-34),Mammalian cell
Code CSB-MP604650CXY
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MNVSTPGFQRCATENEMIGRTAFLFQSNVYTNNIIAIITWTLTVVVLRKLYTKSIFPNST LVLLVASLAVGSIHEFLYGFIQNWSLLRSLVYWDQPCKIMFNEYECYPFYTANIFIRLLM ICTNCAITIDRLITLSNVGIKSTAQRGIVLFILSILVSVGVCMYMTSDGPNDNLQSNCFQ RQGRNIDELTTQIMIYLYIIAICLSLNTIGWFISWRNLKKDKFNLAVQMSKQESINSSLV VTWYLVSQIIFLGLYSILIYAVIKLKDVIGPLLVTNVVLWCYTYTYACMFLPIIILTSTK IISLQRREKINGLTKENQNENQKSYFDKLDRSWSQGYGNRYAPNVPAPVVCINSS
Expression Region 1-355
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

sra-34 Antibodies

sra-34 Antibodies for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.