Recombinant Sheep Growth/differentiation factor 9 (GDF9)

In Stock
Code CSB-EP009352SH
Abbreviation Recombinant Sheep GDF9 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(GDF-9)
Species
Ovis aries (Sheep)
Source
E.coli
Expression Region
319-453aa
Target Protein Sequence
DQESASSELKKPLVPASVNLSEYFKQFLFPQNECELHDFRLSFSQLKWDNWIVAPHKYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIHEKLDSSVPRPSCVPAKYSPLSVLAIEPDGSIAYKEYEDMIATKCTCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for ovarian folliculogenesis.
Gene References into Functions
  1. The detection and identification of single nucleotide polymorphisms in exon 2 of GDF9 gene in Kermani sheep breed using PCR-SSCP are reported. PMID: 27487501
  2. c.978A>G and c.994G>A SNPs are genetic markers for fecundity in Araucana creole sheep PMID: 27110683
  3. study concluded that growth differentiation factor 9 and bone morphogenic protein 15 follow stage-specific pattern of expression during the in vivo development of ovarian follicles in sheep, and in vitro culture altered these changes PMID: 26474685
  4. Analysis of data on Belclare sheep revealed a significant association between V371M mutation og GDF9 and ovulation rate. PMID: 24751660
  5. The Lleyn breed was the most likely source of the BMP15 FecX(G) and GDF9 FecG(H) mutations in Belclare and Cambridge sheep, and the BMP15 FecX(B) mutation came from the High Fertility line developed from prolific ewes in commercial flocks in Ireland. PMID: 23301039
  6. GDF9 genotypes did not have any significant effect on reproduction traits in Mehraban ewes. PMID: 23583795
  7. We have identified a missense mutation in the bioactive part of the GDF9 protein that shows strong association with litter size in NWS. PMID: 23280002
  8. These results preliminarily indicated that allele D of GDF9 gene was a potential genetic marker for improving litter size in Small Tail Han sheep. PMID: 21184179
  9. Homozygosity for a single base-pair mutation in the oocyte-specific GDF9 gene results in sterility in Thoka sheep. PMID: 19713444
  10. 11-point mutations of BMP1B, BMP15, and GDF9 genes of 97 Bonpala ewes were genotyped. PMID: 21774623
  11. A significant association was found between GDF9 gene HhaI polymorphism and litter size in fat-tailed sheep. The heterozygous genotype showed higher litter size. PMID: 21327517
  12. Study found a new allele of GDF9, named FecG, which leads to an amino acid substitution in a conserved position; homozygote ewes presenting the FecG(E) allele have shown an increase in their ovulation rate (82%) and prolificacy (58%). PMID: 20528846
  13. These heterozygous genotypes resulted in higher ovulation rates, illustrating that one copy of each of the BMP15 and GDF9 mutations had equivalent effects on the ovulation rate. PMID: 19144040
  14. The findings of this study point to a preliminary supposition that mutations of both the FecB locus of BMPR1B gene and G1 locus of GDF9 gene might be major determinant to influence prolificacy in the Garole sheep. PMID: 20020203
  15. Sequence of the complete coding region of GDF9 gene and determination of the patterns of expression of mRNAs encoding GDF9. PMID: 17715428
  16. Expression patterns of 4 maternal effect genes (ZAR1, MATER, GDF9, and BMP15) were determined in ovine oocytes and in vitro-produced preimplantation embryos. PMID: 19007555

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

KEGG: oas:100217402

UniGene: Oar.12657

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*