Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase(icaB)

In Stock
Code CSB-EP751939SKY
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q7A349
Abbreviation icaB
Relevance Catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. N-deacetylation is crucial for attachment of the polysaccharide to the bacterial cell surface; it leads to the introduction of positive charges in the otherwise neutral PIA polymer, allowing electrostatic interactions
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP751939SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP751939SKY could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain N315) icaB.
Storage Buffer Tris-based buffer,50% glycerol
Species Staphylococcus aureus (strain N315)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD
Research Area Others
Source E.coli
Gene Names icaB
Protein Names Biofilm polysaccharide intercellular adhesin deacetylase Short name: Biofilm PIA deacetylase Intercellular adhesion protein B
Expression Region 29-290aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 35.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. N-deacetylation is crucial for attachment of the polysaccharide to the bacterial cell surface; it leads to the introduction of positive charges in the otherwise neutral PIA polymer, allowing electrostatic interactions (By similarity).
Subcellular Location Secreted, cell wall
Protein Families Polysaccharide deacetylase family
Database Links

KEGG: sau:SA2461

Related Products

icaB Antibodies

icaB Antibodies for Staphylococcus aureus (strain N315)

icaB Proteins

icaB Proteins for Staphylococcus aureus (strain N315)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.