Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp)

In Stock
Code CSB-EP643953FLF
Abbreviation Recombinant Staphylococcus aureus chp protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
chp
Uniprot No.
Research Area
Others
Alternative Names
(CHIPS)
Species
Staphylococcus aureus (strain NCTC 8325 / PS 47)
Source
E.coli
Expression Region
29-149aa
Target Protein Sequence
FTFEPFPTNEEIESNKKLLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp) is expressed in E. coli and consists of the full-length mature protein, covering amino acids 29 to 149. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag to make purification and detection more straightforward. SDS-PAGE analysis shows the product has a purity greater than 90%, which appears suitable for detailed research studies.

The chemotaxis inhibitory protein from S. aureus seems to play a role in modulating host immune responses. It likely works by interfering with chemotactic signaling pathways. This protein has become important for understanding how bacteria evade immune responses and manipulate host immunity, which is why it's drawing attention in microbial pathogenesis and immunology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant CHP protein are unverified and cannot be assumed. The protein is expressed in E. coli as the mature protein fragment (29-149aa) with both N- and C-terminal tags, which could potentially interfere with the correct folding required for its biological activity (inhibiting chemotaxis). The high purity (>90%) confirms a lack of significant contaminants but does not provide evidence of a proper three-dimensional structure. Therefore, any application that depends on the protein's specific biological function (e.g., binding to its natural targets) is speculative without experimental validation.

1. Antibody Development and Immunoassay Studies

This recombinant CHP protein is suitable for use as an immunogen to generate specific antibodies. The dual-tag system provides flexible options for detection and purification during antibody screening. The >90% purity is adequate for immunization protocols and subsequent characterization (e.g., by ELISA). However, antibodies generated will primarily recognize linear epitopes or the tags themselves. Their ability to bind the natively folded, functional CHP protein in a biological context is not guaranteed and would need to be confirmed.

2. Protein-Protein Interaction Studies

The dual tags make this protein practical for pull-down or co-immunoprecipitation assays to identify potential binding partners. However, a critical caveat is that any interaction detected is entirely contingent on the recombinant CHP protein being correctly folded. A negative result in such an assay could be due to a lack of genuine binding partners or, equally, due to the bait protein being misfolded and inactive.

3. Biochemical Characterization and Stability Studies

This recombinant CHP protein is well-suited for biochemical and biophysical characterization, including studies of thermal stability, pH tolerance, and protease resistance. The high purity is beneficial for techniques like circular dichroism spectroscopy to analyze secondary structure. The tags offer detection methods. This application is largely independent of the protein's native bioactivity, as it focuses on intrinsic physicochemical properties.

4. Competitive Binding Assays

The recombinant CHP protein could be used in competitive binding assays only if its bioactivity is first confirmed. The tags facilitate immobilization or detection. Using this unvalidated protein in such assays risks generating misleading data, as an inability to compete could be misinterpreted as a lack of binding affinity rather than a lack of activity in the recombinant protein itself.

Final Recommendation & Action Plan

The immediate and necessary priority is to establish a functional assay to confirm the protein's bioactivity, such as its ability to inhibit neutrophil or leukocyte chemotaxis in a cell-based assay, before proceeding with applications that rely on specific biological interactions (Applications 2 and 4). A positive result would validate its use in functional studies, while a negative result would limit its utility to structural/biophysical characterization (Application 3) and as an immunogen for generating linear-epitope antibodies (Application 1). Until functional activity is demonstrated, data from binding or interaction studies should be interpreted with extreme caution.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium.
Subcellular Location
Secreted.
Protein Families
CHIPS/FLIPr family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*