Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

In Stock
Code CSB-YP692021FLBb0
Abbreviation Recombinant Staphylococcus aureus clfA protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
clfA
Uniprot No.
Research Area
others
Alternative Names
clfA; SACOL0856Clumping factor A; Fibrinogen receptor A; Fibrinogen-binding protein A
Species
Staphylococcus aureus (strain COL)
Source
Yeast
Expression Region
229-559aa
Target Protein Sequence
GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.5kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Clumping factor A (clfA) is produced in a yeast expression system, covering amino acids 229-559. This partial protein comes with an N-terminal 10xHis-tag for easier purification and detection. The product achieves purity levels over 90%, as confirmed by SDS-PAGE analysis. It's designed strictly for research use and appears to deliver reliable performance in experimental contexts without endotoxin interference.

Clumping factor A plays a crucial role in how Staphylococcus aureus causes disease, particularly in bacterial adhesion and aggregation. The protein binds to fibrinogen—a process that seems essential for colonization and infection of host tissues. Understanding clfA's function may be vital for developing insights into bacterial behavior and potential therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Fibrinogen Binding Studies

This recombinant clfA fragment (229-559aa) can help investigate how Staphylococcus aureus adheres to fibrinogen at the molecular level, since clumping factor A appears to mediate bacterial attachment to this host protein. The N-terminal His-tag makes purification and immobilization straightforward for surface plasmon resonance or ELISA-based binding assays. Researchers might examine binding kinetics, specificity, and how mutations within this region affect fibrinogen interaction. High purity (>90%) should ensure reliable and reproducible binding data without interference from contaminating proteins.

2. Antibody Development and Characterization

The purified recombinant clfA protein works well as an immunogen for generating polyclonal or monoclonal antibodies against Staphylococcus aureus clumping factor A. This specific amino acid region (229-559aa) represents a defined antigenic target that could be used to raise antibodies with known epitope specificity. The His-tag allows easy purification and quantification of the antigen for immunization protocols and subsequent antibody validation assays. These antibodies might prove valuable as research tools for studying S. aureus pathogenesis and bacterial surface protein expression.

3. Protein-Protein Interaction Screening

The His-tagged clfA fragment works in pull-down assays to identify novel host cell proteins that interact with clumping factor A during bacterial infection. The recombinant protein can be immobilized on nickel-affinity matrices and incubated with cell lysates or purified protein libraries to capture potential binding partners. Mass spectrometry analysis of pulled-down proteins may reveal previously unknown interactions relevant to S. aureus pathogenesis. This approach offers insights into the molecular basis of bacterial adhesion and host cell recognition mechanisms.

4. Structural and Biochemical Characterization

This recombinant clfA fragment provides material for detailed structural studies including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to understand the three-dimensional architecture of this adhesion domain. High purity and defined boundaries (229-559aa) make it suitable for biophysical analyses such as circular dichroism spectroscopy to assess secondary structure content and thermal stability. Dynamic light scattering experiments can determine the oligomerization state and solution behavior of this protein region. Such structural information appears crucial for understanding the molecular basis of clumping factor A function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps.
Subcellular Location
Secreted, cell wall; Peptidoglycan-anchor.
Protein Families
Serine-aspartate repeat-containing protein (SDr) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*