Recombinant Staphylococcus aureus Clumping factor A(clfA),partial

In Stock
Code CSB-YP692021FLBb0
Product Type Recombinant Protein
Size US$2959
Uniprot No. Q5HHM8
Lead Time 3-7 business days
Relevance Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fibrinogen receptor A Fibrinogen-binding protein A
Species Staphylococcus aureus (strain COL)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Research Area others
Source Yeast
Gene Names clfA
Expression Region 229-559aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 38.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity).
Subcellular Location Secreted, cell wall, Peptidoglycan-anchor
Protein Families Serine-aspartate repeat-containing protein (SDr) family
Database Links

KEGG: sac:SACOL0856

STRING: 93062.SACOL0856

Related Products

clfA Antibodies

clfA Antibodies for Staphylococcus aureus (strain COL)

clfA Proteins

clfA Proteins for Staphylococcus aureus (strain COL)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.