Recombinant Staphylococcus aureus Clumping factor A (clfA), partial

In Stock
Code CSB-YP692021FLBb0
Abbreviation Recombinant Staphylococcus aureus clfA protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
clfA
Uniprot No.
Research Area
others
Alternative Names
clfA; SACOL0856Clumping factor A; Fibrinogen receptor A; Fibrinogen-binding protein A
Species
Staphylococcus aureus (strain COL)
Source
Yeast
Expression Region
229-559aa
Target Protein Sequence
GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.5kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Clumping factor A (clfA) is produced in a yeast expression system, covering amino acids 229-559. This partial protein comes with an N-terminal 10xHis-tag for easier purification and detection. The product achieves purity levels over 90%, as confirmed by SDS-PAGE analysis. It's designed strictly for research use and appears to deliver reliable performance in experimental contexts without endotoxin interference.

Clumping factor A plays a crucial role in how Staphylococcus aureus causes disease, particularly in bacterial adhesion and aggregation. The protein binds to fibrinogen—a process that seems essential for colonization and infection of host tissues. Understanding clfA's function may be vital for developing insights into bacterial behavior and potential therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant clfA protein may not be correctly folded or fully bioactive without experimental validation. clfA is a bacterial adhesin that requires proper folding for its fibrinogen-binding function, and the yeast expression system, while eukaryotic, may not fully replicate the native bacterial folding environment. The protein is partial length (229-559aa), which might exclude critical regions needed for complete activity, such as full-domain integrity or post-translational modifications. The N-terminal 10xHis tag is relatively small and may not severely interfere with folding, but it could cause steric hindrance near functional sites. The purity >90% indicates low contaminants, but does not guarantee correct folding. Without validation (e.g., circular dichroism for secondary structure, fibrinogen-binding assays), the folding status and bioactivity remain uncertain. Therefore, while the probability of correct folding is moderate, it is not assured.

1. Antibody Development and Characterization

This recombinant clfA is suitable for antibody generation, but antibody specificity depends on the protein's folding state. If correctly folded, antibodies may recognize native epitopes; if misfolded, they could target non-conformational epitopes, reducing utility for detecting physiological clfA. The His-tag aids purification but may dominate immune responses. For reliable antibodies, validate specificity against native clfA or use tag-free protein.

2. Protein-Protein Interaction Screening

The His-tagged clfA fragment can be used in pull-down assays, but interactions may be tag-mediated or non-specific if the protein is misfolded. The partial length might truncate binding interfaces, leading to false negatives. For biologically relevant results, validate folding first and include controls (e.g., tag-only or misfolded protein) to distinguish specific interactions. Mass spectrometry analysis should be interpreted cautiously without folding confirmation.

3. Structural and Biochemical Characterization

This recombinant clfA is applicable for structural studies only if the His-tag is removed and folding is validated. The tag and partial length may cause heterogeneity, hindering high-resolution structure determination (e.g., in crystallography or NMR). Biophysical analyses (e.g., circular dichroism) can assess folding, but data may be confounded by the tag. For meaningful insights, use tag-free protein and confirm native-like structure.

Final Recommendation & Action Plan

To ensure reliable outcomes, first validate the folding and bioactivity of the recombinant clfA using techniques such as circular dichroism to confirm secondary structure, fibrinogen-binding assays (e.g., ELISA or SPR) to verify function, and size-exclusion chromatography to assess oligomeric state. If possible, remove the His-tag for structural and functional studies to minimize artifacts. For applications like antibody development, proceed with caution and include controls for tag specificity. Always compare results with full-length or native clfA standards to account for partial length limitations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps.
Subcellular Location
Secreted, cell wall; Peptidoglycan-anchor.
Protein Families
Serine-aspartate repeat-containing protein (SDr) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*