Home
Protein
Recombinant Proteins
Recombinant Staphylococcus aureus Probable transglycosylase isaA (isaA)

Recombinant Staphylococcus aureus Probable transglycosylase isaA (isaA)

^{In Stock}

Code	CSB-EP350770SUL
Abbreviation	Recombinant Staphylococcus aureus isaA protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

isaA

Uniprot No.

P60157

Research Area

Cell Biology

Alternative Names

isaA; MW2490Probable transglycosylase IsaA; EC 3.2.-.-; Immunodominant staphylococcal antigen A

Species

Staphylococcus aureus (strain MW2)

Source

E.coli

Expression Region

30-233aa

Target Protein Sequence

AEVNVDQAHLVDLAHNHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the general approach to express the recombinant Staphylococcus aureus (strain MW2) isaA protein, a plasmid encoding the Staphylococcus aureus (strain MW2) isaA protein (30-233aa) is first constructed. The constructed plasmid is then introduced into e.coli cells. Plasmid-containing e.coli cells are screened and cultured under conditions that induce the protein expression. The protein is fused with a N-terminal 10xHis tag and C-terminal Myc tag. Lysing the cultured cells and purifying the resulting recombinant isaA protein through affinity purification. The SDS-PAGE analysis is conducted to confirm the presence of the recombinant isaA protein and assess its purity. Its purity is over 85%.