Recombinant Staphylococcus epidermidis Extracellular cysteine protease (ecpA)

In Stock
Code CSB-EP314893SLD
Abbreviation Recombinant Staphylococcus epidermidis ecpA protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ecpA
Uniprot No.
Research Area
Others
Alternative Names
Staphopain
Species
Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Source
E.coli
Expression Region
222-395aa
Target Protein Sequence
MYAEYVNQLKNFRIRETQGYNSWCAGYTMSALLNATYNTNRYNAESVMRYLHPNLRGHDFQFTGLTSNEMLRFGRSQGRNTQYLNRMTSYNEVDQLTTNNQGIAVLGKRVESSDGIHAGHAMAVAGNAKVNNGQKVILIWNPWDNGLMTQDAHSNIIPVSNGDHYEWYASIYGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus epidermidis Extracellular cysteine protease (ecpA) is expressed in E. coli with a C-terminal 6xHis tag for easier purification and detection. The product represents the full length of the mature protein, spanning amino acids 222 to 395. SDS-PAGE analysis indicates a purity level greater than 90%, which should provide reliable results for most experimental applications.

The extracellular cysteine protease (ecpA) from Staphylococcus epidermidis appears to play an important role in protein degradation. This may contribute to how the bacteria acquire nutrients and interact with their hosts. The enzyme seems to be involved in various proteolytic pathways, which makes it an interesting research target for those studying bacterial physiology and pathogenicity. Understanding how ecpA functions could help researchers explore bacterial survival mechanisms and the complex dynamics between hosts and pathogens.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Staphylococcus epidermidis extracellular cysteine protease is expressed in E. coli, a prokaryotic system that may be suitable for expressing bacterial proteins, as it shares a similar cellular environment. However, proteases like this often require precise folding, disulfide bond formation, or post-translational modifications for activity, which E. coli may not always achieve reliably. Since the protein's activity is explicitly unknown and unvalidated, it cannot be assumed to be correctly folded or bioactive. The expression of the full-length mature protein (222-395aa) increases the likelihood of proper folding, but without functional assays (e.g., protease activity tests), the folding and bioactivity remain uncertain. Thus, experimental validation is essential.

1. Biochemical Characterization and Enzyme Kinetics Studies

This application is appropriate but highly dependent on correct folding and activity. The recombinant protease can be used for biochemical studies, but since activity is unconfirmed, initial experiments must focus on verifying proteolytic function using fluorogenic or chromogenic substrates. The C-terminal 6xHis tag facilitates purification, and >90% purity is suitable for assays. If the protein is misfolded or inactive, kinetic measurements and inhibitor screening will be invalid. Therefore, activity confirmation is a prerequisite for reliable results.

2. Antibody Development and Immunological Studies

This application is generally suitable. The recombinant protein can serve as an immunogen for antibody generation, even if misfolded, as antibodies may recognize linear epitopes useful for techniques like Western blotting. The 6xHis tag simplifies purification and quantification. However, antibodies produced against a potentially misfolded protein might not bind the native protease in physiological contexts, so validation against natural S. epidermidis samples is recommended.

3. Protein-Protein Interaction Studies

This application requires correct protein folding to ensure authentic interactions. The 6xHis tag allows immobilization for pull-down assays, but if the protease is misfolded, it may not bind true substrates or partners (e.g., from bacterial or host lysates), leading to false results. The high purity reduces background, but folding must be validated first. If inactive, this application should be avoided or results interpreted with caution.

4. Inhibitor Screening and Drug Discovery Research

This application critically depends on bioactivity. The recombinant protease could be used for inhibitor screening, but only if it is correctly folded and active. The 6xHis tag enables immobilization for high-throughput assays, and >90% purity supports reliability. However, without activity confirmation, screening may identify non-specific inhibitors or yield misleading data. Preliminary activity tests are essential before proceeding.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the priority should be to validate the protein's conformation and function before any application. Recommend performing initial protease activity assays (e.g., using synthetic substrates) and biophysical characterization (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) to confirm folding. If active, the protein can be used for all described applications; if inactive, focus on non-functional uses like antibody development or as a negative control. Always include appropriate controls and consider alternative expression systems if folding issues persist. For interaction or inhibitor studies, correlate findings with native protein data when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cysteine protease able to cleave elastin, insulin, myoglobin, fibronectin, fibrinogen, HMW-kininogen, alpha-1-protease inhibitor and alpha-1-antitrypsin. Along with other extracellular proteases may contribute to the colonization and infection of human tissues.
Subcellular Location
Secreted, cell wall. Secreted.
Protein Families
Peptidase C47 family
Database Links

KEGG: sep:SE0184

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*