Recombinant Triangle waterfern Cyanovirin-N homolog

Code CSB-YP309974CGPb0
Product Type Recombinant Protein
Size US$2959
Uniprot No. P86326
Relevance Mannose-binding lectin
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Ceratopteris richardii (Triangle waterfern)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Research Area Others
Source Yeast
Expression Region 28-142aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 14.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mannose-binding lectin.
Protein Families Cyanovirin-N family

Related Products

Antibodies

Antibodies for Ceratopteris richardii (Triangle waterfern)

Proteins

Proteins for Ceratopteris richardii (Triangle waterfern)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.