Recombinant Triticum aestivum Granule-bound starch synthase 1,chloroplastic/amyloplastic (WAXY), partial

In Stock
Code CSB-EP333285TQN
Abbreviation Recombinant Triticum aestivum WAXY protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333285TQN could indicate that this peptide derived from E.coli-expressed Triticum aestivum (Wheat) WAXY.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333285TQN could indicate that this peptide derived from E.coli-expressed Triticum aestivum (Wheat) WAXY.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
WAXY
Uniprot No.
Research Area
Others
Alternative Names
WAXY; Granule-bound starch synthase 1; chloroplastic/amyloplastic; EC 2.4.1.242; Granule-bound starch synthase I; GBSS-I
Species
Triticum aestivum (Wheat)
Source
E.coli
Expression Region
79-349aa
Target Protein Sequence
LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 79-349 constitute the expression domain of recombinant Wheat WAXY. This WAXY protein is expected to have a theoretical molecular weight of 35.8 kDa. This WAXY recombinant protein is manufactured in e.coli. The N-terminal 10xHis tag and C-terminal Myc tag was smoothly integrated into the coding gene of WAXY, which enables a simple process of detecting and purifying the WAXY recombinant protein in the following steps.

Granule-bound starch synthase 1 (WAXY) in Triticum aestivum, commonly known as wheat, is a chloroplastic/amyloplastic enzyme involved in starch biosynthesis. WAXY plays a crucial role in converting glucose into starch, a complex polysaccharide that serves as a major storage form of energy in plants. WAXY is responsible for synthesizing the granule-bound fraction of starch, which constitutes a significant portion of the starch granule. In chloroplasts, WAXY contributes to starch synthesis during photosynthesis, converting the sugars produced by the plant into starch for storage. In amyloplasts, WAXY is involved in starch accumulation in storage organs like seeds and tubers. The enzyme catalyzes the elongation of starch chains by adding glucose units, leading to the formation of amylose and amylopectin, the two main components of starch. Understanding the function of WAXY is crucial for improving crop yield and quality in wheat and other cereal crops. Genetic modifications targeting WAXY expression can potentially enhance starch content, alter starch composition, and influence the nutritional and processing properties of wheat grains.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Plastid, chloroplast. Plastid, amyloplast. Note=Amyloplast or chloroplast, granule-bound.
Protein Families
Glycosyltransferase 1 family, Bacterial/plant glycogen synthase subfamily
Tissue Specificity
Found in seeds and pollen.
Database Links

UniGene: Ta.2795

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*