Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx1/CMx3

In Stock
Code CSB-EP675990TQN
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q43723
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Triticum aestivum (Wheat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKGSLLQDMSRCKKLTREFIAGIVGRE
Research Area others
Source E.coli
Protein Names ITRL-1/ITRL-3
Expression Region 25-121aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 31.4 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families Protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family
Database Links

UniGene: Ta.1550

Related Products

Antibodies

Antibodies for Triticum aestivum (Wheat)

Proteins

Proteins for Triticum aestivum (Wheat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.