Recombinant Triticum aestivum Omega-5 gliadin, partial

In Stock
Code CSB-EP2020TQN
Abbreviation Recombinant Triticum aestivum Omega-5 gliadin protein, partial
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Species
Triticum aestivum (Wheat)
Source
E.coli
Expression Region
262-439aa
Target Protein Sequence
QQQFPQQQSPQQQQFPQQQFPQQQQLPQKQFPQPQQIPQQQQIPQQPQQFPQQQFPQQQQFPQQQEFPQQQFPQQQFHQQQLPQQQFPQQQFPQQQFPQQQQFPQQQQLTQQQFPRPQQSPEQQQFPQQQFPQQPPQQFPQQQFPIPYPPQQSEEPSPYQQYPQQQPSGSDVISISGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Triticum aestivum Omega-5 gliadin is an E.coli cell-expressed partial protein. E.coli expression systems are popular because bacteria are easy to culture, grow fast and produce high yields of recombinant protein. Traditional strategies for Triticum aestivum Omega-5 gliadin recombinant protein expression involve transforming the recombinant plasmid into the E. coli host. The cells were directly replicated, transcribed and translated, and IPTG was added to express the desired protein. Typically, the cells are then lysed to extract the expressed protein for subsequent purification. Also, many proteins become insoluble as inclusion bodies that are very difficult to recover, so mild conditions and subsequent cumbersome protein-refolding procedures are used to ensure the final provided protein is soluble.

Omega-5 gliadin is a protein component of gluten in triticum aestivum (wheat). Different to gliten proteins, omega gliadins are distinguished from the others on the basis of their amino acid compositions, being exceptionally rich in proline and glutamine with little or no methionine and cysteine. TOf the wheat allergens, omega-5 gliadin has been implicated as the most frequent trigger of WDEIA. Omega-5 gliadin allergy is a rare wheat allergy that presents with severe anaphylaxis. Exercise is the key co-factor, and other known co-factors include alcohol, menstruation and aspirin/NSAIDs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*