Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
Cruzipain; EC 3.4.22.51; Cruzaine; Major cysteine proteinase
Species
Trypanosoma cruzi
Expression Region
123-467aa
Target Protein Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVGGPGPTPEPTTTTTTSAPGPSPSYFVQMSCTDAACIVGCENVTLPTGQCLLTTSGVSAIVTCGAETLTEEVFLTSTHCSGPSVRSSVPLNKCNRLLRGSVEFFCGSSSSGRLADVDRQRRHQPYHSRHRRL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Enhance your study on parasitic diseases with our Recombinant Trypanosoma cruzi Cruzipain. This product features the protein Cruzipain, also known as Cruzaine, the major cysteine proteinase in Trypanosoma cruzi. The enzyme plays a crucial role in the life cycle of the parasite, especially in its interactions with host organisms, making it a fascinating target for parasitology and infectious disease research.
This recombinant Cruzipain covers the full length of the mature protein, specifically the amino acid region from 123-467. It is expressed in E.coli and carries N-terminal 10xHis and C-terminal Myc tags, facilitating convenient purification and detection. The Recombinant Trypanosoma cruzi Cruzipain shows a purity greater than 85% as determined by SDS-PAGE, ensuring the high quality of the protein. It comes in either a liquid form or a lyophilized powder, adaptable to your experimental needs. This product opens up possibilities for further understanding the pathogenesis of Chagas disease and the exploration of potential therapeutic targets.
