Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P25779

Research Area

Others

Alternative Names

Cruzipain; EC 3.4.22.51; Cruzaine; Major cysteine proteinase

Species

Trypanosoma cruzi

Source

E.coli

Expression Region

123-467aa

Target Protein Sequence

APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVGGPGPTPEPTTTTTTSAPGPSPSYFVQMSCTDAACIVGCENVTLPTGQCLLTTSGVSAIVTCGAETLTEEVFLTSTHCSGPSVRSSVPLNKCNRLLRGSVEFFCGSSSSGRLADVDRQRRHQPYHSRHRRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

43.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Enhance your study on parasitic diseases with our Recombinant Trypanosoma cruzi Cruzipain. This product features the protein Cruzipain, also known as Cruzaine, the major cysteine proteinase in Trypanosoma cruzi. The enzyme plays a crucial role in the life cycle of the parasite, especially in its interactions with host organisms, making it a fascinating target for parasitology and infectious disease research.

This recombinant Cruzipain covers the full length of the mature protein, specifically the amino acid region from 123-467. It is expressed in E.coli and carries N-terminal 10xHis and C-terminal Myc tags, facilitating convenient purification and detection. The Recombinant Trypanosoma cruzi Cruzipain shows a purity greater than 85% as determined by SDS-PAGE, ensuring the high quality of the protein. It comes in either a liquid form or a lyophilized powder, adaptable to your experimental needs. This product opens up possibilities for further understanding the pathogenesis of Chagas disease and the exploration of potential therapeutic targets.

Target Background

Function

Hydrolyzes chromogenic peptides at the carboxyl Arg or Lys; requires at least one more amino acid, preferably Arg, Phe, Val or Leu, between the terminal Arg or Lys and the amino-blocking group.; The cysteine protease may play an important role in the development and differentiation of the parasites at several stages of their life cycle.

Protein Families

Peptidase C1 family

Code	CSB-EP333107TQY
Abbreviation	Recombinant Trypanosoma cruzi Cruzipain protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Trypanosoma cruzi Cruzipain

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage