Recombinant Vaccinia virus Complement control protein C3 (VACWR025)

In Stock
Code CSB-YP302389VAI
Abbreviation Recombinant Vaccinia virus VACWR025 protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
VACWR025
Uniprot No.
Research Area
Microbiology
Alternative Names
VACWR025; C3L; Complement control protein C3; 28 kDa protein; Secretory protein 35; Protein C3; VCP
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Source
Yeast
Expression Region
20-263aa
Target Protein Sequence
CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Complement control protein C3 (VACWR025) is produced in yeast and contains the complete mature protein sequence from amino acids 20 to 263. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the protein achieves greater than 90% purity, suggesting consistent quality for experimental work. This product is designed for research use only.

The Vaccinia virus Complement control protein C3 appears to play a key role in dampening host immune responses. It seems to contribute to the virus's strategy for avoiding immune detection by blocking parts of the complement system—a critical component of our innate immune defenses. Studying how this protein works and what it interacts with may be essential for understanding viral disease mechanisms and immune system dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Vaccinia virus VACWR025 is produced in a yeast expression system as a partial fragment (20-263aa) with an N-terminal 6xHis-tag. This viral protein is designed to interact with and regulate the host complement system, requiring precise folding and functional domain integrity for its immune evasion activity. While yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, viral proteins often have unique structural requirements that may not be fully replicated in heterologous systems. The partial nature of the fragment (missing potential N-terminal residues) and the presence of the His-tag may affect proper folding and functional activity. No validation data (e.g., complement binding assays, functional activity tests) are provided. Therefore, while yeast expression increases the probability of correct folding compared to prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Complement System Interaction Studies

If correctly folded, this recombinant protein could be used to study interactions with human complement proteins, as the His-tag facilitates immobilization for binding assays. However, if misfolded, functional domains may be altered, leading to non-specific binding or failure to recognize genuine complement components, compromising the validity of viral immune evasion mechanisms studied.

2. Antiviral Drug Screening Platform

If properly folded and functional, the protein could serve as a target for screening compounds that disrupt viral complement evasion. However, if misfolded, screening would identify false positives/negatives, as the protein would not accurately represent the native viral protein's interaction with complement factors.

3. Antibody Development and Characterization

This application is suitable, as antibody generation primarily relies on linear epitope recognition. The high purity and defined fragment support consistent immunization results. However, if misfolded, antibodies may not optimally recognize conformational epitopes of the native viral protein in biological contexts.

4. Protein Structure-Function Analysis

If correctly folded, the fragment could provide insights into the viral protein's structural features. However, if misfolded, structural data would misrepresent the native architecture, and the partial nature limits understanding of full-length protein function in complement regulation.

Final Recommendation & Action Plan

This yeast-expressed partial viral protein requires validation before functional applications due to the unique structural requirements of viral immune evasion proteins and the challenges of expressing them in heterologous systems; the recommended action plan includes: first validating folding through biophysical methods (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (complement binding or inhibition tests); if validation confirms proper folding and activity, proceed with applications while noting the limitations of the partial fragment; if misfolded, consider using alternative expression systems (e.g., mammalian cells) that may better support viral protein folding or obtain a commercially validated standard; for immediate use, antibody development can proceed but validate antibodies against native viral protein; avoid functional studies until proper folding and bioactivity are confirmed. Always include appropriate controls (e.g., known complement proteins, validated inhibitors) in experiments to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.
Gene References into Functions
  1. These data suggest that glycosylation did not affect the human C3 binding activity of vaccinia virus complement control protein and thus may not have contributed to the attenuation of the mutant LC16m8 virus. PMID: 25030055
  2. These results suggest that complement control protein contributes to virulence by dampening both antibody and T cell responses. PMID: 21191012
Subcellular Location
Virion membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Extracellular side. Secreted. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Anchored to the surface of the outermost membrane of EEV via its interaction with A56 protein.
Protein Families
Receptors of complement activation (RCA) family
Database Links

KEGG: vg:3707640

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*