Recombinant Vaccinia virus Complement control protein C3 (VACWR025)

In Stock
Code CSB-YP302389VAI
Abbreviation Recombinant Vaccinia virus VACWR025 protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VACWR025
Uniprot No.
Research Area
Microbiology
Alternative Names
VACWR025; C3L; Complement control protein C3; 28 kDa protein; Secretory protein 35; Protein C3; VCP
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Source
Yeast
Expression Region
20-263aa
Target Protein Sequence
CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Complement control protein C3 (VACWR025) is produced in yeast and contains the complete mature protein sequence from amino acids 20 to 263. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. SDS-PAGE analysis shows the protein achieves greater than 90% purity, suggesting consistent quality for experimental work. This product is designed for research use only.

The Vaccinia virus Complement control protein C3 appears to play a key role in dampening host immune responses. It seems to contribute to the virus's strategy for avoiding immune detection by blocking parts of the complement system—a critical component of our innate immune defenses. Studying how this protein works and what it interacts with may be essential for understanding viral disease mechanisms and immune system dynamics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Complement System Interaction Studies

This recombinant protein could prove useful for examining how viruses evade immune responses through laboratory-based complement binding experiments. The N-terminal 6xHis tag allows for protein purification and attachment to surfaces in techniques like surface plasmon resonance or ELISA studies when characterizing interactions with human complement proteins. Scientists might investigate how vaccinia virus alters host complement activation during infection. The high purity level (>90%) appears suitable for precise biochemical studies of complement regulatory activity.

2. Antiviral Drug Screening Platform

The purified protein may serve as a target in large-scale screening experiments designed to find small molecules that interfere with viral complement evasion. The His-tag makes protein capture simpler in plate-based assays when testing chemical libraries. Researchers could develop biochemical tests that measure protein-complement interactions and hunt for compounds that restore normal complement activity. This strategy might help advance our understanding of viral disease mechanisms while identifying promising antiviral targets.

3. Antibody Development and Characterization

The recombinant protein can function as an immunogen or antigen for creating research antibodies directed against vaccinia virus complement control proteins. The His-tag allows for relatively simple purification and measurement in immunization procedures or ELISA-based antibody testing. Scientists could generate specific antibodies for examining viral protein production, cellular location, and activity in infected cells. These antibodies would likely become valuable research tools for studying vaccinia virus behavior and complement system interactions.

4. Protein Structure-Function Analysis

The purified recombinant protein may be valuable in biophysical experiments aimed at understanding the structural characteristics of vaccinia virus complement control regions. Researchers could apply techniques like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to examine protein folding and stability. The high purity level supports thorough biochemical analysis, including mass spectrometry and controlled proteolysis experiments. These studies might reveal important details about the molecular mechanisms behind viral complement regulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.
Gene References into Functions
  1. These data suggest that glycosylation did not affect the human C3 binding activity of vaccinia virus complement control protein and thus may not have contributed to the attenuation of the mutant LC16m8 virus. PMID: 25030055
  2. These results suggest that complement control protein contributes to virulence by dampening both antibody and T cell responses. PMID: 21191012
Subcellular Location
Virion membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Extracellular side. Secreted. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Anchored to the surface of the outermost membrane of EEV via its interaction with A56 protein.
Protein Families
Receptors of complement activation (RCA) family
Database Links

KEGG: vg:3707640

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*