Home
Protein
Recombinant Proteins
Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial

Recombinant Vibrio cholerae serotype O1 Cholera toxin transcriptional activator (toxR), partial

Code	CSB-EP322805VEX
Abbreviation	Recombinant Vibrio cholerae serotype O1 toxR protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Target Names

toxR

Uniprot No.

P15795

Research Area

Others

Species

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Source

E.coli

Expression Region

19-127aa

Target Protein Sequence

KFILAEKFTFDPLSNTLIDKEDSEEIIRLGSNESRILWLLAQRPNEVISRNDLHDFVWREQGFEVDDSSLTQAISTLRKMLKDSTKSPQYVKTVPKRGYQLIARVETVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.93.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

This transcription activator controls cholera toxin, pilus colonization factor and outer membrane protein expression in V.cholerae. It binds to the 5'-TTTTGAT-3' tandemly repeated DNA sequence in the cholera toxin promoter region. ToxS interacts with the C-terminal periplasmic domain of ToxR, stimulating its activity. It activates transcription at the promoters for tcpI and tcpA and this is presumably via ToxT.

Subcellular Location

Cell membrane; Single-pass membrane protein.

Database Links

KEGG: vch:VC0984

STRING: 243277.VC0984

Promotions