Your Good Partner in Biology Research
Tel : 301-363-4651
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
Your Good Partner in Biology Research
CD47｜Proteinase K｜EGFR｜BCMA｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
| Code | CSB-EP764949ZAT |
| Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | L |
| Uniprot No. | Q6V1Q2 |
| Research Area | others |
| Alternative Names | LRNA-directed RNA polymerase L; Protein L; Large structural protein; Replicase; Transcriptase) [Includes: RNA-directed RNA polymerase; EC 2.7.7.48); mRNA; guanine-N(7)-)-methyltransferase; EC 2.1.1.56); GDP polyribonucleotidyltransferase; EC 2.7.7.88); Cap-specific mRNA; nucleoside-2'-O-)-methyltransferase 2; EC 2.1.1.296)] |
| Species | Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus) |
| Source | E.coli |
| Expression Region | 625-809aa |
| Target Protein Sequence | RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 27.9kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
| Function | RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene. |
| Subcellular Location | Host cytoplasm, Virion |
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide
