Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

VP40

Uniprot No.

Q77DJ6

Research Area

Others

Alternative Names

VP40Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40

Species

Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

Source

Baculovirus

Expression Region

1-326aa

Target Protein Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

39.1

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).

Gene References into Functions

Modulation of the VP40-SUMO (SUMOylation) interaction may represent a novel target for the therapy of Ebola virus infection. PMID: 27849047
This VP40 hexamer-hexamer interface is crucial in forming the Ebola viral matrix and disruption of this interface may provide a method to use graphene or similar nanoparticle based solutions as a disinfectant that can significantly reduce the spread of the disease and prevent an Ebola epidemic. PMID: 28917841
Interdomain salt-bridges in the Ebola virus protein VP40 and their role in domain association and plasma membrane localization. PMID: 27328459
Analysis of binding utilizing surface plasmon resonance for several mAbs and sdAb specific for VP40 from Ebola virus. PMID: 28109682
Data indicate that cell penetrable human scFvs (transbodies) to Zaire Ebolavirus (EBOV) VP40 were produced. PMID: 27638305
Taken together, these studies suggest that PM phosphatidylserine may be an important component of Ebola virus budding and that VP40 may be able to mediate PM scission. PMID: 25315776
Results provide a functional model for ebolavirus matrix assembly and the other roles of VP40 in the virus life cycle and demonstrate how a single wild-type, unmodified polypeptide can assemble into different structures for different functions.[Ebola virus Mayinga strain] PMID: 23953110
Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress. PMID: 23637409
VP40 membrane penetration is an important step in the plasma membrane localization of the matrix protein where oligomerization and budding are defective in the absence of key hydrophobic interactions with the membrane PMID: 23297401
In addition to viral protein 35 (VP35), we found that VP30 and VP40 independently act as suppressor of RNA silencing. PMID: 21228243
VP40 directly enhances tubulin polymerization without any cellular mediators. PMID: 15795257
enhance our understanding of Ebola virus assembly and in so doing move us closer to the identification of targets for the development of antiviral compounds to combat Ebola virus infection PMID: 17229682
VP40 sequence that may be essential for Ebola virus budding, through the generation of deletion and alanine-scanning mutants. PMID: 17940963
We found that Sec24C, a component of the host COPII vesicular transport system, interacts specifically with VP40 via VP40 amino acids 303 to 307. PMID: 18329616

Hide All

Subcellular Location

Host cytoplasm. Host cell membrane. Virion membrane; Peripheral membrane protein. Host late endosome membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Cytoplasmic side. Host endomembrane system; Peripheral membrane protein. Secreted, extracellular exosome.

Protein Families

Filoviridae matrix protein VP40 family

Database Links

KEGG: vg:911825

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-BP762349ZAT
MSDS	MSDS
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage