Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

In Stock
Code CSB-BP762349ZAT
Abbreviation Recombinant Zaire ebolavirus VP40 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VP40
Uniprot No.
Research Area
Others
Alternative Names
VP40Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40
Species
Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Source
Baculovirus
Expression Region
1-326aa
Target Protein Sequence
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.1
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant Zaire ebolavirus Matrix protein VP40 in baculovirus involves co-cloning the gene encoding the full-length VP40 protein (1-326aa) into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene, followed by transformation into baculovirus cells. These cells are cultured under conditions that promote protein expression. After sufficient growth is achieved, the cells are lysed to release the recombinant Zaire ebolavirus Matrix protein VP40. Protein purification is performed by affinity chromatography. Its purity is assessed using SDS-PAGE, exceeding 85%.

Zaire ebolavirus Matrix protein VP40 is a crucial component involved in the assembly and budding of the Ebola virus. VP40 plays a central role in virion formation and egress from host cells [1]. It is essential for driving the final stage of Ebola virus replication, which involves the budding of new virus particles from infected cells [2]. VP40 is the most abundant protein in Ebola virus particles, contributing to their filamentous structure and variations in length [3]. The protein facilitates viral budding by interacting with the host cell plasma membrane and promoting the formation of filamentous virus particles [4].

Studies have shown that VP40 forms octamers vital for Ebola virus replication [5]. VP40 has been found to interact with other viral proteins and host factors to mediate specific virus-host interactions necessary for efficient virion release [6]. The protein has also been associated with acetylation modifications that impact its function in virus assembly and release [7].

Furthermore, VP40 has been linked to the organization of the Ebola virus structure, forming a lattice within the viral envelope and interacting with the nucleocapsid to facilitate the assembly of virus particles [8]. It possesses conserved motifs that enable interactions with ubiquitin ligases, further influencing the budding process of filoviruses.

References:
[1] S. Yamayoshi and Y. Kawaoka, Role of the gtpase rab1b in ebolavirus particle formation, Journal of Virology, vol. 84, no. 9, p. 4816-4820, 2010. https://doi.org/10.1128/jvi.00010-10
[2] L. Zhang, S. Zhou, M. Chen, J. Yan, Y. Yang, L. Wuet al., P300-mediated nedd4 acetylation drives ebolavirus vp40 egress by enhancing nedd4 ligase activity, Plos Pathogens, vol. 17, no. 6, p. e1009616, 2021. https://doi.org/10.1371/journal.ppat.1009616
[3] T. Hoenen, V. Volchkov, L. Kolesnikova, E. Mittler, J. Timmins, M. Ottmannet al., Vp40 octamers are essential for ebola virus replication, Journal of Virology, vol. 79, no. 3, p. 1898-1905, 2005. https://doi.org/10.1128/jvi.79.3.1898-1905.2005
[4] K. Johnson, N. Bhattarai, M. Budicini, C. LaBonia, S. Baker, B. Gerstmanet al., Cysteine mutations in the ebolavirus matrix protein vp40 promote phosphatidylserine binding by increasing the flexibility of a lipid-binding loop, Viruses, vol. 13, no. 7, p. 1375, 2021. https://doi.org/10.3390/v13071375
[5] R. Harty, No exit: targeting the budding process to inhibit filovirus replication, Antiviral Research, vol. 81, no. 3, p. 189-197, 2009. https://doi.org/10.1016/j.antiviral.2008.12.003
[6] D. Hatakeyama, N. Ohmi, A. Saitoh, K. Makiyama, M. Morioka, H. Okazakiet al., Acetylation of lysine residues in the recombinant nucleoprotein and vp40 matrix protein of zaire ebolavirus by eukaryotic histone acetyltransferases, Biochemical and Biophysical Research Communications, vol. 504, no. 4, p. 635-640, 2018. https://doi.org/10.1016/j.bbrc.2018.09.007
[7] D. Beniac, P. Melito, S. deVarennes, S. Hiebert, M. Rabb, L. Lambooet al., The organisation of ebola virus reveals a capacity for extensive, modular polyploidy, Plos One, vol. 7, no. 1, p. e29608, 2012. https://doi.org/10.1371/journal.pone.0029608
[8] R. Harty, M. Brown, G. Wang, J. Huibregtse, & F. Hayes, A ppxy motif within the vp40 protein of ebola virus interacts physically and functionally with a ubiquitin ligase: implications for filovirus budding, Proceedings of the National Academy of Sciences, vol. 97, no. 25, p. 13871-13876, 2000. https://doi.org/10.1073/pnas.250277297

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).
Gene References into Functions
  1. Modulation of the VP40-SUMO (SUMOylation) interaction may represent a novel target for the therapy of Ebola virus infection. PMID: 27849047
  2. This VP40 hexamer-hexamer interface is crucial in forming the Ebola viral matrix and disruption of this interface may provide a method to use graphene or similar nanoparticle based solutions as a disinfectant that can significantly reduce the spread of the disease and prevent an Ebola epidemic. PMID: 28917841
  3. Interdomain salt-bridges in the Ebola virus protein VP40 and their role in domain association and plasma membrane localization. PMID: 27328459
  4. Analysis of binding utilizing surface plasmon resonance for several mAbs and sdAb specific for VP40 from Ebola virus. PMID: 28109682
  5. Data indicate that cell penetrable human scFvs (transbodies) to Zaire Ebolavirus (EBOV) VP40 were produced. PMID: 27638305
  6. Taken together, these studies suggest that PM phosphatidylserine may be an important component of Ebola virus budding and that VP40 may be able to mediate PM scission. PMID: 25315776
  7. Results provide a functional model for ebolavirus matrix assembly and the other roles of VP40 in the virus life cycle and demonstrate how a single wild-type, unmodified polypeptide can assemble into different structures for different functions.[Ebola virus Mayinga strain] PMID: 23953110
  8. Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress. PMID: 23637409
  9. VP40 membrane penetration is an important step in the plasma membrane localization of the matrix protein where oligomerization and budding are defective in the absence of key hydrophobic interactions with the membrane PMID: 23297401
  10. In addition to viral protein 35 (VP35), we found that VP30 and VP40 independently act as suppressor of RNA silencing. PMID: 21228243
  11. VP40 directly enhances tubulin polymerization without any cellular mediators. PMID: 15795257
  12. enhance our understanding of Ebola virus assembly and in so doing move us closer to the identification of targets for the development of antiviral compounds to combat Ebola virus infection PMID: 17229682
  13. VP40 sequence that may be essential for Ebola virus budding, through the generation of deletion and alanine-scanning mutants. PMID: 17940963
  14. We found that Sec24C, a component of the host COPII vesicular transport system, interacts specifically with VP40 via VP40 amino acids 303 to 307. PMID: 18329616

Show More

Hide All

Subcellular Location
Host cytoplasm. Host cell membrane. Virion membrane; Peripheral membrane protein. Host late endosome membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Cytoplasmic side. Host endomembrane system; Peripheral membrane protein. Secreted, extracellular exosome.
Protein Families
Filoviridae matrix protein VP40 family
Database Links

KEGG: vg:911825

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*