Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

In Stock
Code CSB-EP762349ZATa0
Abbreviation Recombinant Zaire ebolavirus VP40 protein
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VP40
Uniprot No.
Research Area
Others
Alternative Names
VP40Matrix protein VP40; Ebola VP40; eVP40; Membrane-associated protein VP40
Species
Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Source
E.coli
Expression Region
1-326aa
Target Protein Sequence
MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis).
Gene References into Functions
  1. Modulation of the VP40-SUMO (SUMOylation) interaction may represent a novel target for the therapy of Ebola virus infection. PMID: 27849047
  2. This VP40 hexamer-hexamer interface is crucial in forming the Ebola viral matrix and disruption of this interface may provide a method to use graphene or similar nanoparticle based solutions as a disinfectant that can significantly reduce the spread of the disease and prevent an Ebola epidemic. PMID: 28917841
  3. Interdomain salt-bridges in the Ebola virus protein VP40 and their role in domain association and plasma membrane localization. PMID: 27328459
  4. Analysis of binding utilizing surface plasmon resonance for several mAbs and sdAb specific for VP40 from Ebola virus. PMID: 28109682
  5. Data indicate that cell penetrable human scFvs (transbodies) to Zaire Ebolavirus (EBOV) VP40 were produced. PMID: 27638305
  6. Taken together, these studies suggest that PM phosphatidylserine may be an important component of Ebola virus budding and that VP40 may be able to mediate PM scission. PMID: 25315776
  7. Results provide a functional model for ebolavirus matrix assembly and the other roles of VP40 in the virus life cycle and demonstrate how a single wild-type, unmodified polypeptide can assemble into different structures for different functions.[Ebola virus Mayinga strain] PMID: 23953110
  8. Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress. PMID: 23637409
  9. VP40 membrane penetration is an important step in the plasma membrane localization of the matrix protein where oligomerization and budding are defective in the absence of key hydrophobic interactions with the membrane PMID: 23297401
  10. In addition to viral protein 35 (VP35), we found that VP30 and VP40 independently act as suppressor of RNA silencing. PMID: 21228243
  11. VP40 directly enhances tubulin polymerization without any cellular mediators. PMID: 15795257
  12. enhance our understanding of Ebola virus assembly and in so doing move us closer to the identification of targets for the development of antiviral compounds to combat Ebola virus infection PMID: 17229682
  13. VP40 sequence that may be essential for Ebola virus budding, through the generation of deletion and alanine-scanning mutants. PMID: 17940963
  14. We found that Sec24C, a component of the host COPII vesicular transport system, interacts specifically with VP40 via VP40 amino acids 303 to 307. PMID: 18329616

Show More

Hide All

Subcellular Location
Host cytoplasm. Host cell membrane. Virion membrane; Peripheral membrane protein. Host late endosome membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein; Cytoplasmic side. Host endomembrane system; Peripheral membrane protein. Secreted, extracellular exosome.
Protein Families
Filoviridae matrix protein VP40 family
Database Links

KEGG: vg:911825

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*