Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Expression Region
27-233aa
Target Protein Sequence
VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human HLA-DMA contains amino acids 27-233. This HLA-DMA protein is theoretically predicted to have a molecular weight of 27.4 kDa. This HLA-DMA recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was smoothly integrated into the coding gene of HLA-DMA, which enables a simple process of detecting and purifying the HLA-DMA recombinant protein in the following steps.
The human leukocyte antigen-DMA (HLA-DMA) protein is a non-classical MHC class II protein that is involved in the peptide-loading process onto MHC class II molecules. Specifically, HLA-DMA acts as a chaperone during the peptide-loading phase in the endosomal compartments of antigen-presenting cells (APCs). It associates with MHC class II molecules and catalyzes the exchange of peptides bound to the MHC class II binding groove. This peptide exchange mechanism allows for the loading of high-affinity peptides onto MHC class II molecules, optimizing the antigen presentation to CD4
+ T cells. The HLA-DMA protein is crucial for the efficient presentation of antigens to CD4
+ T cells, which, in turn, triggers appropriate immune responses against pathogens. Understanding the functions of HLA-DMA is essential for unraveling the complexities of antigen presentation and immune regulation.
