RecombinantMouseAquaporin-4(Aqp4),partial

In Stock
Code CSB-YP001964MO1
Size US$576Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP001964MO1 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Aqp4.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP001964MO1 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Aqp4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Aqp4
Uniprot No. P55088
Research Area others
Alternative Names Aqp4Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4
Species Mus musculus (Mouse)
Source Yeast
Expression Region 253-323aa
Target Protein Sequence CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 9.9kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Gene References into Functions
  1. The Aqp4 pool is drastically reduced in the skeletal muscle of mdx3cv mice, which have no dystrophin. PMID: 18284610
  2. Aquaporin 4 mislocalization away from astroglia and glia limitans delays the onset of brain edema PMID: 12232046
  3. AQP4 and alpha1-syntrophin colocalized frequently at the astrocyte membrane, especially at the perivascular astrocyte endfoot processes PMID: 12233788
  4. plays a critical role in inner ear fluid homeostasis and hearing PMID: 12359252
  5. role of accumulation in astroglial end-feet in dissipation of bidirectional water flow between blood and brain PMID: 12578959
  6. AQP-4 provides the principal route for water transport in astrocytes. PMID: 14576087
  7. water flux through perivascular AQP4 is needed to sustain efficient removal of K+ after neuronal activation PMID: 14597704
  8. AQP4 is expressed in brain endothelial cells & in the perivascular membranes of astrocyte endfeet. There are 3 distinct & serially coupled pools of AQP4 at the brain-blood interface. PMID: 14734638
  9. Sarcolemma vesicles from mdx mice show AQP4 loss from the plasma membrane & a big reduction in water permeability, implying a major role for aquaporins in skeletal muscle physiology & involvement of AQP4 in molecular changes in muscles of DMD patients. PMID: 15033928
  10. higher-order organization of AQP4 increases single-channel osmotic water permeability by one order of magnitude and that differential cellular expression levels of the two isoforms could regulate this organization. PMID: 15149973
  11. AQP4-mediated transcellular water movement is crucial for fluid clearance in vasogenic brain edema. PMID: 15208268
  12. a novel role for AQP4 as a regulator of brain extracellular space PMID: 15371505
  13. AQP4 deletion in mice is neuroprotective in a transient ischemia model of retinal injury, suggesting the possible use of AQP4 inhibitors in retinal vascular occlusive and ischemic diseases. PMID: 15557457
  14. AQP4-labeled astrocytic processes surround blood vessels, neuronal perikarya and processes, and both asymmetric and symmetric synapses: the protein may be involved in the regulation of water fluxes around both inhibitory and excitatory synapses. PMID: 15789430
  15. Data show that the sustained inhibition of gastric secretion due to tumours producing PYY/enteroglucagon in transgenic mice is associated with an increase in AQP4 expression and a down-regulation of H(+)/K(+)-ATPase in parietal cells. PMID: 15898955
  16. aquaporin-4 has species-specific roles in astrocytes and a functional relationship with Connexin43 PMID: 16103109
  17. Protective effect of AQP4 on brain swelling in bacterial abscess. AQP4 induction may reduce vasogenic edema associated with cerebral infection. PMID: 16181429
  18. Lead exposure induced a significant, 40%, increase in water permeability in astrocytes expressing AQP4, but had no effect on permeability in astrocytes not expressing AQP4. May contribute to acute lead intoxication. PMID: 16203098
  19. The lack of AQP4 expression is accompanied by sex- and region-specific alterations in brain amino acid and monoamine metabolism in mice. PMID: 16237719
  20. the involvement of aquaporin-4 in astroglial cell migration, which occurs during glial scar formation in brain injury, stroke, tumor and focal abscess. PMID: 16303850
  21. These results implicate AQP4 in the expression and termination of seizure activity and support the hypothesis that AQP4 is coupled to potassium homeostasis in vivo. PMID: 16470808
  22. These results suggest that AQP4, but not AQP1 or AQP9, may play an important role in water movement associated with the pathophysiology of edema after transient cerebral ischemia in the mouse. PMID: 16511868
  23. Modulation of AQP4 expression or function may be a novel therapeutic strategy for a variety of cerebral disorders including stroke, tumor, infection, hydrocephalus, epilepsy, and traumatic brain injury. PMID: 16564496
  24. A significant increase in the expression levels of AQP1 and AQP4 was found in mice at 270 dpi, the time corresponding with the appearance of PrP(res) immunoreactivity in Western blots and typical spongiform lesions in the brain. PMID: 16871401
  25. These findings provide direct evidences for the first time that aquaporin-4 plays an important role in the function of glutamate transporters. PMID: 17074507
  26. These findings reveal for the first time that AQP4 regulates not only water and ion homeostasis but also the functions of ovarian hormone and neurotransmitter. PMID: 17196551
  27. AQP4 showed a heterogeneous distribution in the central nervous system, but in some areas, an inverse correlation between AQP4 and extracellular matrix components has been observed, suggesting a complementary role for maintenance of water homeostasis PMID: 17349777
  28. This study demonstrates that AQP4 is important in the MPTP neurotoxic process and indicates that the therapeutic strategy targeted to astrocytic modulation with AQP4 may offer a great potential for the development of new treatment for PD. PMID: 17353068
  29. In conclusion, AQP4 mediates bidirectional transport of water across astrocytes during HI and reoxygenation. AQP4 manipulation may serve as a novel therapeutic strategy during different periods of hypoxic-ischemic brain edema in neonates. PMID: 17437301
  30. Evidence against functionally significant AQP4 modulation of Muller cell Kir4.1 potassium channel functionin retinal Muller cells. PMID: 17525153
  31. aquaporin-4 participates in the regulation of neurotransmitter release induced by depolarizing stimuli. PMID: 17611025
  32. A marked increase in AQP4 was observed in mice at the terminal stage of BSE, when they had a wide range of clinical signs, whereas no increase could be observed in the early stage before the onset of the clinical signs. PMID: 17868659
  33. This study report multiple lines of evidence against functionally significant AQP4-Kir4.1 interactions. PMID: 17869537
  34. Palmitoylated dystrobrevin restored alpha-syntrophin and aquaporin-4 (AQP4) to the mdx sarcolemma but was unable to recruit beta-dystroglycan or the sarcoglycans PMID: 18057022
  35. AQP4 is essential for the maintenance of blood-brain barrier integrity. PMID: 18281883
  36. Muller glial cells respond to excessive light with an alteration in the localization of aquaporin-4 protein; this alteration is thought to be a response to the edema in the outer retina and may support the resolution of edema. PMID: 18328627
  37. AQP4 deficiency alleviates proinflammatory cytokine release from astrocytes, in association with the SPHK1/MAPK/AKT pathway. PMID: 29956748
  38. Low expression of AQP4 is associated with Human immunodeficiency virus-associated nephropathy. PMID: 29608911
  39. This study demonstrated that the significant improvement in blood-brain barrier (BBB) permeability was observed in the AQP4-deficient ALS mouse model. PMID: 29154923
  40. Brain water content decreased following treatment with 3% HS relative to the TBI group. This was accompanied by decreases in AQP4, TNF-alpha, and IL-1beta mRNA and protein levels. PMID: 29600800
  41. Treatment with goreisan significantly decreased both brain water content and AQP4 expression in the ischemic brain at 24 hours after middle cerebral artery occlusion. PMID: 29153303
  42. The findings of this study demonstrated a novel molecular mechanism involving the SUR1-TRPM4-AQP4 complex to account for bulk water influx during astrocyte swelling. PMID: 28906027
  43. The findings of this study suggest that AQP4 KO leads to increased aggregation of Cx43 into gap junctions and provide a putative mechanistic basis for the enhanced tracer coupling in hippocampi of AQP4 KO mice. PMID: 28551776
  44. Interaction of the IgG-AQP4 complex with FcgammaRs triggers coendocytosis of the excitatory amino acid transporter 2. PMID: 28461494
  45. The diffusive and AQP4-independent solute transport in rodent brain parenchyma has been demonstrated. PMID: 28826498
  46. Present study demonstrated that AQP4 depolarization is a widespread pathological condition and may contribute to motor neuron degeneration in ALS. PMID: 28627708
  47. Dataindicate that astrocytes in the substantia nigra differ from those in neocortex by showing a higher level of aquaporin-4, particularly in those endfoot membrane domains that mediate water exchange between brain and blood. PMID: 28735099
  48. AQP4-specific T cells contribute to AQP4-targeted CNS autoimmunity PMID: 27940915
  49. AQP-4 expression was significantly elevated in the ipsilateral hemisphere in the first 24h following cerebral cortical injury in mice and this could be correlated with worsening of neurological function. Over the next 48h, there was a trend towards decrease in AQP-4 expression that was associated with partial recovery of neurological function. PMID: 28645746
  50. Study shows that the size of the aquaporin-4 (Aqp4) pool differs considerably between brain regions, roughly mirroring regional differences in Aqp4 mRNA copy numbers. PMID: 27629271

Show More

Hide All

Subcellular Location Membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: mmu:11829

STRING: 10090.ENSMUSP00000078088

UniGene: Mm.250786

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1