Recombinant ABC transporter ATP-binding protein/permease wht-1(wht-1)

Code CSB-CF612113CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q11180
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MPKRRVKEILHNVSGMAESGKLLAILGSSGAGKTTLMNVLTSRNLTNLDVQGSILIDGRR ANKWKIREMSAFVQQHDMFVGTMTAREHLQFMARLRMGDQYYSDHERQLRVEQVLTQMGL KKCADTVIGIPNQLKGLSCGEKKRLSFASEILTCPKILFCDEPTSGLDAFMAGHVVQALR SLADNGMTVIITIHQPSSHVYSLFNNVCLMACGRVIYLGPGDQAVPLFEKCGYPCPAYYN PADHLIRTLAVIDSDRATSMKTISKIRQGFLSTDLGQSVLAIGNANKLRAASFVTGSDTS EKTKTFFNQDYNASFWTQFLALFWRSWLTVIRDPNLLSVRLLQILITAFITGIVFFQTPV TPATIISINGIMFNHIRNMNFMLQFPNVPVITAELPIVLRENANGVYRTSAYFLAKNIAE LPQYIILPILYNTIVYWMSGLYPNFWNYCFASLVTILITNVAISISYAVATIFANTDVAM TILPIFVVPIMAFGGFFITFDAIPSYFKWLSSLSYFKYGYEALAINEWDSIKVIPECFNS SMTAFALDSCPKNGHQVLESIDFSASHKIFDISILFGMFIGIRIIAYVALLIRSYNNT
Source in vitro E.coli expression system
Gene Names wht-1
Protein Names Recommended name: ABC transporter ATP-binding protein/permease wht-1
Expression Region 1-598
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity Expressed in the intestine in both larvae and adults.
Database Links

KEGG: cel:CELE_C05D10.3

STRING: 6239.C05D10.3

UniGene: Cel.10888

Related Products

wht-1 Antibodies

wht-1 Antibodies for Caenorhabditis elegans

wht-1 Proteins

wht-1 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.