Recombinant African swine fever virus Envelope protein p54

Code CSB-CF717644AEC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q65272
Storage Buffer Tris-based buffer,50% glycerol
Species African swine fever virus (isolate Pig/Portugal/Lis 60/1960) (ASFV)
Sequence MDSEFFQPVYPRHYGECLSPTSTPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTD NPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLE NSL
Source in vitro E.coli expression system
Protein Names Recommended name: Envelope protein p54
Expression Region 1-183
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis (By similarity).
Subcellular Location Virion membrane, Single-pass membrane protein
Protein Families Asfivirus envelope protein p54 family

Related Products

Proteins

Proteins for African swine fever virus (isolate Pig/Portugal/Lis 60/1960) (ASFV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.