Product Details

Target Names

Ba71V-126

Uniprot No.

Q65194

Alternative Names

Ba71V-126; E183L; Envelope protein p54

Species

African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Expression Region

1-183

Target Protein Sequence

MDSEFFQPVYPRHYGECLSPVTPPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTD NPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLE NSL

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Description

The recombinant ASFV Ba71V-126 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, Ba71V-126 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

Ba71V-126, also called envelop protein p54, is a very important ASFV antigenic structural protein. p54 has been localized in the envelope precursors as well as in both intracellular and extracellular mature particles. It is essential for virus viability and takes part in the early steps of virus infection. Studies have shown that p54 is required for the recruitment of envelope precursors to assembly sites and plays a central role in virus growth and the induction of specific antibodies following inoculation of pigs with attenuated virus strains.

Target Background

Function

Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope.

Subcellular Location

Virion membrane; Single-pass membrane protein. Host cytoplasm, host cytoskeleton. Host endoplasmic reticulum membrane.

Protein Families

Asfivirus envelope protein p54 family

Database Links

KEGG: vg:22220355

Code	CSB-CF731137AEJ
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant African swine fever virus Envelope protein p54 (Ba71V-126)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage