Recombinant African swine fever virus Envelope protein p54 (Ba71V-126)

Code CSB-CF731137AEJ
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ba71V-126
Uniprot No.
Alternative Names
Ba71V-126; E183L; Envelope protein p54
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Expression Region
1-183
Target Protein Sequence
MDSEFFQPVYPRHYGECLSPVTPPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTD NPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLE NSL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.
Description

The recombinant ASFV Ba71V-126 protein is a cell-free system in vitro E.coli expressed Full Length protein. In cell-free systems, synthesis of the protein can be carried out in vitro using extracts of whole cells that are compatible with translation. These cell extracts contain all the molecules and enzymes that are needed to transcribe, translate, and post-translationally modify the recombinant protein. With additional supplements of cofactors, Ba71V-126 proteins can be formed in a few hours. However, this system may not be applicable for the large-scale production of recombinant proteins. Advantages of this system include that proteins can be synthesized without cell culturing; also, it is possible to express many proteins together.

Ba71V-126, also called envelop protein p54, is a very important ASFV antigenic structural protein. p54 has been localized in the envelope precursors as well as in both intracellular and extracellular mature particles. It is essential for virus viability and takes part in the early steps of virus infection. Studies have shown that p54 is required for the recruitment of envelope precursors to assembly sites and plays a central role in virus growth and the induction of specific antibodies following inoculation of pigs with attenuated virus strains.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Envelope protein involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward viral factories. Seems to induce caspase-3 activation and apoptosis. Plays a role in virion morphogenesis by recruiting and transforming the host ER membranes into the precursors of the viral envelope.
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cytoplasm, host cytoskeleton. Host endoplasmic reticulum membrane.
Protein Families
Asfivirus envelope protein p54 family
Database Links

KEGG: vg:22220355

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1