Recombinant African swine fever virus Transmembrane protein C257L (Mal-074)

Code CSB-CF316669AYE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CAB8
Storage Buffer Tris-based buffer,50% glycerol
Species African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Sequence MYSVCDVVRDAVAQSHLCACPNDKLPQCKGVTKAPPECSVFHLAKLQDTKFKWKYTLDPL KAQKLDQINKDIEKDAITLKLIYGTELSPEDVEWWKMQRCLINKNTGAKGGQFAHKYLER QDLELLGYSPTSLIGGDLMFTALPDKVLRTIPVVWDRFLNPAMMIFFLIILLCIILGIFY VLVRNTLRRKQKSKQHQMEIKRFIKEKEQDPYIHTSFESWPADPNKEWKELIPVYEAQGY CMADYRKKLGMPPVPNC
Source in vitro E.coli expression system
Gene Names Mal-074
Protein Names Recommended name: Transmembrane protein C257L Short name= pC257L
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Asfivirus C257R family

Related Products

Mal-074 Proteins

Mal-074 Proteins for African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.