Recombinant Aquifex aeolicus Uncharacterized protein aq_555 (aq_555)

Code CSB-CF524103DNV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O66830
Storage Buffer Tris-based buffer,50% glycerol
Species Aquifex aeolicus (strain VF5)
Sequence MSSFASFLDMWRDLDKYLSSLTIFNIQSSFMRIFLLFLFFVLFTFGVEGYVIEEINGSTG LRIHKEIKRKVYITEDALITETEKEFMVQKIENGLPRIYRVIKSSKSYMDFSKMTPLFLV SLPFLDCKQRVCVVNRGAFRPTNEYKKIRGFKARKVVVESHALGKKTTLIQWYTKEWKEL VEANRLEDKFYVNFIRAIMKEKNLSEANIPLKEIQNFLKEINEKFGGVVRTQQQMPLFNT YSEVISVKKTEIPDYIYKLPEGYTKIK
Source in vitro E.coli expression system
Gene Names aq_555
Protein Names Recommended name: Uncharacterized protein aq_555
Expression Region 1-267
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: aae:aq_555

STRING: 224324.aq_555

Related Products

aq_555 Proteins

aq_555 Proteins for Aquifex aeolicus (strain VF5)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.