Recombinant Arabidopsis thaliana Bidirectional sugar transporter SWEET11 (SWEET11)

Code CSB-CF874470DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SWEET11
Uniprot No.
Alternative Names
SWEET11; At3g48740; T21J18.1; T8P19.250; Bidirectional sugar transporter SWEET11; AtSWEET11; Protein SUGARS WILL EVENTUALLY BE EXPORTED TRANSPORTERS 11
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-289
Target Protein Sequence
MSLFNTENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLW LYYATQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILL LCQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPEVSLDM LKLGTVSSPEPISVVRQANKCTCGNDRRAEIEDGQTPKHGKQSSSAAAT
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Involved in phloem loading by mediating export from parenchyma cells feeding H(+)-coupled import into the sieve element/companion cell complex, thus contributing to the sucrose migration from sites of synthesis in the mesophyll to the phloem. Contributes to seed filling by triggering sucrose efflux involved in the transfer of sugars from seed coat to embryos.
Gene References into Functions
  1. Data indicate that the transcript levels of sucrose transporters AtSUC2, AtSWEET11, AtSWEET12 and AtSWEET15 were significantly higher in stressed roots. PMID: 26802041
  2. in addition to their contribution to phloem loading in source leaves, the AtSWEET11 and AtSWEET12 proteins act as sugar exporters that deliver carbon-containing skeletons to developing xylem cells in order to support secondary cell wall formation PMID: 26358680
  3. SWEET11, 12, and 15 exhibit specific spatiotemporal expression patterns in developing seeds. PMID: 25794936
  4. identified subfamily of SWEET sucrose efflux transporters; AtSWEET11 and 12 localize to plasma membrane of phloem; mutant plants carrying insertions in AtSWEET11 and 12 are defective in phloem loading evealing a 2 step mechanism of SWEET-mediated export PMID: 22157085
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
SWEET sugar transporter family
Tissue Specificity
Expressed in leaves, especially in phloem. Expressed in developing seeds.
Database Links

KEGG: ath:AT3G48740

STRING: 3702.AT3G48740.1

UniGene: At.27455

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×