Recombinant Arabidopsis thaliana CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1(PIS1)

Code CSB-CF818518DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8LBA6
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MAKKERPRPEKLSVYLYIPNIVGYMRVLLNCVAFAVCFSNKPLFSVLYFFSFCCDAVDGW VARRFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTF LAGKSSHKDVKDSTSWLFRLYYGNRIFMCYCCVSCEVLYIILLLIAKNQSENLLNVVVAT LTQISPLSFLLALTLFGWSMKQTINVIQMKTAADVCVLYDIEKQQKP
Source in vitro E.coli expression system
Gene Names PIS1
Protein Names Recommended name: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase 1 Short name= AtPIS1 Short name= PI synthase 1 Short name= PtdIns synthase 1
Expression Region 1-227
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families CDP-alcohol phosphatidyltransferase class-I family
Tissue Specificity Expressed in stems, flowers, shoots and roots. Present in epidermal tissues.
Database Links

KEGG: ath:AT1G68000

STRING: 3702.AT1G68000.1

UniGene: At.24677

Related Products

PIS1 Antibodies

PIS1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

PIS1 Proteins

PIS1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.