Recombinant Arabidopsis thaliana Cellulose synthase-like protein G1(CSLG1)

Code CSB-CF707125DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q570S7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence METHRKNSVVGNILHTCHPCRRTIPYRIYAIFHTCGIIALMYHHVHSLVTANNTLITCLL LLSDIVLAFMWATTTSLRLNPVHRTECPEKYAAKPEDFPKLDVFICTADPYKEPPMMVVN TALSVMAYEYPSDKISVYVSDDGGSSLTFFALIEAAKFSKQWLPFCKKNNVQDRSPEVYF SSESHSRSDEAENLKMMYEDMKSRVEHVVESGKVETAFITCDQFRGVFDLWTDKFSRHDH PTIIQVLQNSETDMDNTRKYIMPNLIYVSREKSKVSPHHFKAGALNTLLRVSGVMTNSPI ILTLDCDMYSNDPATLVRALCYLTDPEIKSGLGYVQFPQKFLGISKNDIYACENKRLFII NMVGFDGLMGPTHVGTGCFFNRRAFYGPPYMLILPEINELKPYRIADKSIKAQDVLSLAH NVAGCIYEYNTNWGSKIGFRYGSLVEDYYTGFMLHCEGWRSVFCNPKKAAFYGDSPKCLV DLVGQQIRWAVGLFEMSFSKYSPITYGIKSLDLLMGLGYCNSPFKPFWSIPLTVYGLLPQ LALISGVSVFPKASDPWFWLYIILFFGAYAQDLSDFLLEGGTYRKWWNDQRMLMIKGLSS FFFGFIEFILKTLNLSTPKFNVTSKANDDDEQRKRYEQEIFDFGTSSSMFLPLTTVAIVN LLAFVWGLYGILFCGGELYLELMLVSFAVVNCLPIYGAMVLRKDDGKLSKRTCFLAGNLH VGSYCVKLLRPQVTSPLRLIHNNNTSGWFKRKKHNMNESV
Source in vitro E.coli expression system
Gene Names CSLG1
Protein Names Recommended name: Cellulose synthase-like protein G1 Short name= AtCslG1 EC= 2.4.1.-
Expression Region 1-760
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family, Plant cellulose synthase-like G subfamily
Tissue Specificity Expressed in young seedlings, primarily in the vascular tissue.
Database Links

KEGG: ath:AT4G24010

STRING: 3702.AT4G24010.1

UniGene: At.32387

Related Products

CSLG1 Antibodies

CSLG1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

CSLG1 Proteins

CSLG1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.