Recombinant Arabidopsis thaliana Cytochrome c-type biogenesis ccda-like chloroplastic protein(CCDA)

Code CSB-CF885541DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9M5P3
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MNLSVNRCITGGFVGGFSSCRLNHEKRWVRAGKHCELERERSLVSDAVSLERLESKSIKL AMLASGLGVANLVTLSSAKAADLKMIVLDQATSIYILAEGSLGDSVGNFLYSANQQANEA VQDQLSALSVTSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRGQVIGDTVAFA LGLATTLALLGIVASFAGKAYGQIGQGLPVAASGLAIVMGLNLLEIIELQLPSFFNNFDP RAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVATSRDPVIGGSLLLTYTTGYV APLIVAASFAGALQSLLSLRKVSAWINPISGALLLGGGLYTFLDRLFPAATMVM
Source in vitro E.coli expression system
Gene Names CCDA
Protein Names Recommended name: Cytochrome c-type biogenesis ccda-like chloroplastic protein Alternative name(s): Cytochrome b6f biogenesis protein CCDA
Expression Region 1-354
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the transfer of reducing equivalents from stroma to thylakoid lumen. Involved in the biogenesis of the plastid cytochrome b6f complex by probably transferring reducing equivalents from stromal m-type thioredoxin (Trx-m) to the lumenal thioredoxin HCF164.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein
Protein Families DsbD family
Database Links

KEGG: ath:AT5G54290

STRING: 3702.AT5G54290.2

UniGene: At.24874

Related Products

CCDA Antibodies

CCDA Antibodies for Arabidopsis thaliana (Mouse-ear cress)

CCDA Proteins

CCDA Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.