Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL31 (ATL31)

Code CSB-CF836557DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ATL31
Uniprot No.
Alternative Names
ATL31; CNI1; SSV1; At5g27420; F21A20.130; E3 ubiquitin-protein ligase ATL31; Protein CARBON/NITROGEN INSENSITIVE 1; Protein SUPER SURVIVAL 1; RING-H2 finger protein ATL31; RING-type E3 ubiquitin transferase ATL31
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
24-368
Target Protein Sequence
QPGTPDQRHDPYAYSGSLSPAMAVVVVVVIAALFFMGFFTVYIRHCTGAVDGSVTPAGGA RRRVTNATVARGLDAETIETFPTFVYSEVKTQKIGKGALECAICLNEFEDDETLRLLPKC DHVFHPHCIGAWLQGHVTCPVCRTNLAEQTPEPEVVVETDLEAQQQSAVPVPVVELPRVK FPRSHTTGHSVVLPGESTDRFTLRVPEELRKKIMANWKLNRSNSVFVLPRGGSSRSGKQV DRSRAKSDRWLFRKTPSFLWRNRDDGSIRLGGTGSVRGNSVTSPSGDSVRADRWAFLRNP SFLWRNTTPVPSPRVEVNNKDGEGTSSVQHIGTVGSTSGSLRLPV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that is required for the plant C/N response during seedling growth transition. May be involved in the early steps of the plant defense signaling pathway.
Gene References into Functions
  1. Gain-of-function lines of VFP4 and ATL31 exhibited recalcitrance to Agrobacterium tumorigenicity, suggesting that A. tumefaciens may utilize the host ubiquitin/proteasome system to destabilize transcriptional regulators of the host disease response machinery. PMID: 29264953
  2. The physiological role of phosphorylation at 14-3-3 binding sites on ATL31 is to modulate the binding ability and stability of 14-3-3 proteins to control plant C/N-nutrient response. PMID: 24722992
  3. Ubiquitin ligase ATL31 regulates senescence when the CO2/N is disrupted. PMID: 24739470
  4. ATL31 targets and ubiquitinates 14-3-3 proteins for degradation via the ubiquitin-proteasome system during the response to cellular C/N status. PMID: 21668537
  5. CNI1/ATL31 activity is required for the plant C/N response during seedling growth transition. PMID: 19702666

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
RING-type zinc finger family, ATL subfamily
Database Links

KEGG: ath:AT5G27420

STRING: 3702.AT5G27420.1

UniGene: At.30807

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×