Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1(RIE1)

Code CSB-CF810150DOA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8GUU2
Storage Buffer Tris-based buffer,50% glycerol
Species Arabidopsis thaliana (Mouse-ear cress)
Sequence MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGRITGHRAPSMLVRETA ARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGLQCL FHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDNSTTYSFVKRCESINTVI SFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAVFCVVLACLVGIALCCCLP CIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEKNITGPGKMVPIPINGLCLATERTL LAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKMRATCPLCKYNILKGTTDQS
Source in vitro E.coli expression system
Gene Names RIE1
Protein Names Recommended name: E3 ubiquitin protein ligase RIE1 EC= 6.3.2.- Alternative name(s): Protein RING-FINGER FOR EMBRYOGENESIS 1
Expression Region 1-359
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable E3 ubiquitin-protein ligase required for embryo development.
Subcellular Location Membrane, Multi-pass membrane protein
Tissue Specificity Widely expressed.
Database Links

KEGG: ath:AT2G01735

STRING: 3702.AT2G01735.1

UniGene: At.47033

Related Products

RIE1 Antibodies

RIE1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RIE1 Proteins

RIE1 Proteins for Arabidopsis thaliana (Mouse-ear cress)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.